Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166RNM4

Protein Details
Accession A0A166RNM4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
71-90ESAPCLKKPRRNGRETDKGWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 7, extr 4, cyto_nucl 4, cyto_pero 4
Family & Domain DBs
Amino Acid Sequences MPYAMAVCANLLILWHLATSGVPDRLKLRSRARTATTRRIYIMRYFSLSADKLKVLGWSYGDELMIAVGTESAPCLKKPRRNGRETDKGWQEAGAVISGGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.05
5 0.05
6 0.09
7 0.11
8 0.15
9 0.15
10 0.17
11 0.19
12 0.25
13 0.29
14 0.34
15 0.39
16 0.44
17 0.49
18 0.53
19 0.56
20 0.6
21 0.63
22 0.66
23 0.61
24 0.54
25 0.51
26 0.47
27 0.44
28 0.39
29 0.36
30 0.27
31 0.25
32 0.23
33 0.22
34 0.23
35 0.21
36 0.17
37 0.14
38 0.13
39 0.11
40 0.11
41 0.12
42 0.1
43 0.1
44 0.1
45 0.1
46 0.11
47 0.11
48 0.1
49 0.09
50 0.08
51 0.07
52 0.06
53 0.04
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.06
60 0.07
61 0.08
62 0.17
63 0.25
64 0.32
65 0.43
66 0.55
67 0.62
68 0.68
69 0.76
70 0.78
71 0.81
72 0.78
73 0.77
74 0.72
75 0.65
76 0.58
77 0.5
78 0.4
79 0.32
80 0.28
81 0.19