Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167TGM1

Protein Details
Accession A0A167TGM1    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MSAHRCWQQTHRRQDRQRVRERRVTLQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 11, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MSAHRCWQQTHRRQDRQRVRERRVTLQTLSSCSQSPVMNPGLSGPRLSHQHSQHPGQPPNMPPQQQQQPMPVPTKRASITYIYIGDTCILP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.89
4 0.91
5 0.9
6 0.86
7 0.84
8 0.81
9 0.79
10 0.75
11 0.69
12 0.6
13 0.56
14 0.5
15 0.46
16 0.42
17 0.34
18 0.27
19 0.23
20 0.24
21 0.17
22 0.16
23 0.15
24 0.16
25 0.14
26 0.14
27 0.15
28 0.15
29 0.15
30 0.15
31 0.11
32 0.12
33 0.15
34 0.19
35 0.23
36 0.23
37 0.31
38 0.35
39 0.37
40 0.4
41 0.45
42 0.45
43 0.41
44 0.43
45 0.37
46 0.41
47 0.43
48 0.4
49 0.34
50 0.39
51 0.45
52 0.46
53 0.46
54 0.44
55 0.45
56 0.48
57 0.52
58 0.46
59 0.42
60 0.39
61 0.42
62 0.37
63 0.33
64 0.32
65 0.3
66 0.31
67 0.3
68 0.3
69 0.26
70 0.25
71 0.23