Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5R195

Protein Details
Accession E5R195    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MVKKRASNGRNKKGRGHVKPIRCSNCSHydrophilic
NLS Segment(s)
PositionSequence
3-18KKRASNGRNKKGRGHV
85-107RVRSREGRRNRAPPPRLRFNKDV
Subcellular Location(s) nucl 16, cyto_nucl 11.333, mito_nucl 11.333, mito 5.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MVKKRASNGRNKKGRGHVKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAVSDISDASVFTKYAVPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRLRFNKDVKKLNPQQAAATAKSAQAAAAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.79
4 0.77
5 0.77
6 0.83
7 0.84
8 0.81
9 0.73
10 0.72
11 0.7
12 0.7
13 0.69
14 0.67
15 0.64
16 0.65
17 0.68
18 0.7
19 0.72
20 0.71
21 0.73
22 0.74
23 0.75
24 0.72
25 0.73
26 0.68
27 0.68
28 0.6
29 0.53
30 0.46
31 0.37
32 0.33
33 0.26
34 0.22
35 0.12
36 0.11
37 0.08
38 0.06
39 0.05
40 0.05
41 0.05
42 0.04
43 0.04
44 0.05
45 0.05
46 0.06
47 0.09
48 0.09
49 0.11
50 0.12
51 0.13
52 0.15
53 0.17
54 0.23
55 0.25
56 0.26
57 0.26
58 0.28
59 0.28
60 0.27
61 0.27
62 0.21
63 0.18
64 0.18
65 0.17
66 0.18
67 0.18
68 0.19
69 0.2
70 0.26
71 0.29
72 0.3
73 0.33
74 0.38
75 0.47
76 0.53
77 0.59
78 0.63
79 0.67
80 0.73
81 0.78
82 0.79
83 0.78
84 0.79
85 0.78
86 0.79
87 0.78
88 0.77
89 0.76
90 0.77
91 0.79
92 0.78
93 0.8
94 0.73
95 0.76
96 0.78
97 0.79
98 0.75
99 0.66
100 0.59
101 0.57
102 0.57
103 0.47
104 0.42
105 0.33
106 0.27
107 0.26
108 0.24
109 0.18