Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166ASN0

Protein Details
Accession A0A166ASN0    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
57-94RSKASPRPRAPSPRRRPSRARPSRSPPRARPSPARPSPBasic
NLS Segment(s)
PositionSequence
39-100RRRPSPRAPSRAWATTAARSKASPRPRAPSPRRRPSRARPSRSPPRARPSPARPSPARSKRS
Subcellular Location(s) nucl 17, cyto_nucl 10, mito 9
Family & Domain DBs
Amino Acid Sequences RTPSRSPTHSQPAPHRSPAGRSASLSSMRTMTQHPSTTRRRPSPRAPSRAWATTAARSKASPRPRAPSPRRRPSRARPSRSPPRARPSPARPSPARSKRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.62
3 0.53
4 0.54
5 0.54
6 0.51
7 0.43
8 0.39
9 0.37
10 0.36
11 0.38
12 0.35
13 0.28
14 0.22
15 0.21
16 0.21
17 0.2
18 0.2
19 0.21
20 0.24
21 0.26
22 0.32
23 0.4
24 0.48
25 0.54
26 0.59
27 0.62
28 0.64
29 0.71
30 0.75
31 0.76
32 0.75
33 0.69
34 0.65
35 0.62
36 0.57
37 0.49
38 0.41
39 0.34
40 0.33
41 0.35
42 0.31
43 0.27
44 0.25
45 0.28
46 0.32
47 0.39
48 0.41
49 0.4
50 0.45
51 0.52
52 0.63
53 0.69
54 0.72
55 0.75
56 0.77
57 0.81
58 0.83
59 0.84
60 0.84
61 0.86
62 0.85
63 0.83
64 0.82
65 0.83
66 0.87
67 0.88
68 0.87
69 0.85
70 0.84
71 0.84
72 0.82
73 0.82
74 0.8
75 0.8
76 0.78
77 0.78
78 0.72
79 0.71
80 0.75