Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166T015

Protein Details
Accession A0A166T015    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MPKDAKPKRKAAEKAEKAPRATKGKKDKNAPKRALSBasic
NLS Segment(s)
PositionSequence
5-33AKPKRKAAEKAEKAPRATKGKKDKNAPKR
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKDAKPKRKAAEKAEKAPRATKGKKDKNAPKRALSAYMFFSQDWRERIKTENPDAGFGEVGKLLGAKWKELDDEEKKPYVEMATKDKVRAEKEKTAYENKTTDKASDEEEAAEASD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.81
4 0.74
5 0.7
6 0.68
7 0.67
8 0.64
9 0.63
10 0.64
11 0.69
12 0.74
13 0.79
14 0.82
15 0.83
16 0.87
17 0.83
18 0.77
19 0.73
20 0.67
21 0.63
22 0.54
23 0.46
24 0.39
25 0.35
26 0.31
27 0.24
28 0.23
29 0.2
30 0.22
31 0.21
32 0.22
33 0.21
34 0.21
35 0.25
36 0.31
37 0.34
38 0.34
39 0.38
40 0.34
41 0.34
42 0.34
43 0.3
44 0.23
45 0.16
46 0.13
47 0.07
48 0.06
49 0.05
50 0.04
51 0.03
52 0.08
53 0.08
54 0.08
55 0.09
56 0.1
57 0.11
58 0.12
59 0.19
60 0.21
61 0.25
62 0.28
63 0.3
64 0.29
65 0.28
66 0.28
67 0.23
68 0.22
69 0.2
70 0.24
71 0.29
72 0.31
73 0.32
74 0.35
75 0.38
76 0.39
77 0.43
78 0.43
79 0.45
80 0.49
81 0.54
82 0.56
83 0.59
84 0.58
85 0.55
86 0.54
87 0.48
88 0.49
89 0.43
90 0.39
91 0.35
92 0.32
93 0.3
94 0.28
95 0.25
96 0.21
97 0.2