Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165WXF3

Protein Details
Accession A0A165WXF3   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
204-236LQPAHRSWKSWKNERKRKNIRRFKSYSRETSRSHydrophilic
NLS Segment(s)
PositionSequence
211-236WKSWKNERKRKNIRRFKSYSRETSRS
238-239SR
243-248GRSRQR
Subcellular Location(s) mito 13, nucl 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MQRPQATPSTPGRSSRQQNTRTVRALYGPSCVREWVQQQVPQPSNVDIAAERQRRRFNIRYDKQEYPASAGQNFLHPHFCHNVEDCQWAWHEGLCDVQDTVTGMARLADVVHIGFAVRAEWNPTVPVQLDNIEIVPTASRQVEQMDGWADVVIKMEDIFRREIALPHILQYSTKLKQIRPPPGHTLDDATRDLMHHPLQLHPDLQPAHRSWKSWKNERKRKNIRRFKSYSRETSRSLSRAVLGRSRQRNLSRGSRLKGGLSGHNGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.65
3 0.67
4 0.66
5 0.72
6 0.75
7 0.76
8 0.72
9 0.65
10 0.57
11 0.51
12 0.51
13 0.42
14 0.41
15 0.36
16 0.33
17 0.32
18 0.31
19 0.28
20 0.28
21 0.3
22 0.31
23 0.34
24 0.36
25 0.41
26 0.49
27 0.5
28 0.46
29 0.45
30 0.37
31 0.33
32 0.29
33 0.24
34 0.15
35 0.18
36 0.26
37 0.31
38 0.33
39 0.38
40 0.44
41 0.48
42 0.56
43 0.58
44 0.59
45 0.64
46 0.69
47 0.72
48 0.73
49 0.72
50 0.68
51 0.65
52 0.55
53 0.5
54 0.45
55 0.37
56 0.3
57 0.28
58 0.24
59 0.25
60 0.26
61 0.21
62 0.23
63 0.21
64 0.23
65 0.25
66 0.26
67 0.24
68 0.25
69 0.27
70 0.23
71 0.26
72 0.23
73 0.21
74 0.2
75 0.18
76 0.16
77 0.14
78 0.13
79 0.1
80 0.11
81 0.1
82 0.1
83 0.09
84 0.08
85 0.07
86 0.07
87 0.07
88 0.07
89 0.06
90 0.06
91 0.06
92 0.06
93 0.06
94 0.05
95 0.05
96 0.04
97 0.04
98 0.04
99 0.03
100 0.03
101 0.03
102 0.03
103 0.04
104 0.04
105 0.04
106 0.07
107 0.07
108 0.08
109 0.08
110 0.09
111 0.09
112 0.09
113 0.1
114 0.08
115 0.08
116 0.09
117 0.08
118 0.08
119 0.07
120 0.06
121 0.06
122 0.05
123 0.04
124 0.05
125 0.05
126 0.05
127 0.06
128 0.07
129 0.08
130 0.07
131 0.08
132 0.08
133 0.08
134 0.08
135 0.08
136 0.07
137 0.06
138 0.07
139 0.05
140 0.04
141 0.04
142 0.06
143 0.07
144 0.09
145 0.1
146 0.1
147 0.12
148 0.12
149 0.14
150 0.15
151 0.17
152 0.16
153 0.16
154 0.17
155 0.15
156 0.15
157 0.17
158 0.2
159 0.18
160 0.23
161 0.24
162 0.25
163 0.32
164 0.41
165 0.48
166 0.48
167 0.52
168 0.55
169 0.57
170 0.57
171 0.51
172 0.47
173 0.38
174 0.36
175 0.31
176 0.25
177 0.2
178 0.19
179 0.19
180 0.18
181 0.16
182 0.15
183 0.15
184 0.17
185 0.21
186 0.22
187 0.22
188 0.19
189 0.23
190 0.22
191 0.22
192 0.25
193 0.23
194 0.3
195 0.31
196 0.33
197 0.36
198 0.43
199 0.51
200 0.56
201 0.64
202 0.67
203 0.76
204 0.83
205 0.87
206 0.9
207 0.92
208 0.93
209 0.94
210 0.91
211 0.91
212 0.89
213 0.88
214 0.87
215 0.85
216 0.84
217 0.82
218 0.78
219 0.72
220 0.7
221 0.68
222 0.6
223 0.53
224 0.44
225 0.39
226 0.39
227 0.39
228 0.4
229 0.4
230 0.47
231 0.53
232 0.56
233 0.61
234 0.61
235 0.64
236 0.63
237 0.66
238 0.67
239 0.67
240 0.68
241 0.66
242 0.62
243 0.57
244 0.54
245 0.48
246 0.44