Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165WXF3

Protein Details
Accession A0A165WXF3    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
204-236LQPAHRSWKSWKNERKRKNIRRFKSYSRETSRSHydrophilic
NLS Segment(s)
PositionSequence
211-236WKSWKNERKRKNIRRFKSYSRETSRS
238-239SR
243-248GRSRQR
Subcellular Location(s) mito 13, nucl 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MQRPQATPSTPGRSSRQQNTRTVRALYGPSCVREWVQQQVPQPSNVDIAAERQRRRFNIRYDKQEYPASAGQNFLHPHFCHNVEDCQWAWHEGLCDVQDTVTGMARLADVVHIGFAVRAEWNPTVPVQLDNIEIVPTASRQVEQMDGWADVVIKMEDIFRREIALPHILQYSTKLKQIRPPPGHTLDDATRDLMHHPLQLHPDLQPAHRSWKSWKNERKRKNIRRFKSYSRETSRSLSRAVLGRSRQRNLSRGSRLKGGLSGHNGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.65
3 0.67
4 0.66
5 0.72
6 0.75
7 0.76
8 0.72
9 0.65
10 0.57
11 0.51
12 0.51
13 0.42
14 0.41
15 0.36
16 0.33
17 0.32
18 0.31
19 0.28
20 0.28
21 0.3
22 0.31
23 0.34
24 0.36
25 0.41
26 0.49
27 0.5
28 0.46
29 0.45
30 0.37
31 0.33
32 0.29
33 0.24
34 0.15
35 0.18
36 0.26
37 0.31
38 0.33
39 0.38
40 0.44
41 0.48
42 0.56
43 0.58
44 0.59
45 0.64
46 0.69
47 0.72
48 0.73
49 0.72
50 0.68
51 0.65
52 0.55
53 0.5
54 0.45
55 0.37
56 0.3
57 0.28
58 0.24
59 0.25
60 0.26
61 0.21
62 0.23
63 0.21
64 0.23
65 0.25
66 0.26
67 0.24
68 0.25
69 0.27
70 0.23
71 0.26
72 0.23
73 0.21
74 0.2
75 0.18
76 0.16
77 0.14
78 0.13
79 0.1
80 0.11
81 0.1
82 0.1
83 0.09
84 0.08
85 0.07
86 0.07
87 0.07
88 0.07
89 0.06
90 0.06
91 0.06
92 0.06
93 0.06
94 0.05
95 0.05
96 0.04
97 0.04
98 0.04
99 0.03
100 0.03
101 0.03
102 0.03
103 0.04
104 0.04
105 0.04
106 0.07
107 0.07
108 0.08
109 0.08
110 0.09
111 0.09
112 0.09
113 0.1
114 0.08
115 0.08
116 0.09
117 0.08
118 0.08
119 0.07
120 0.06
121 0.06
122 0.05
123 0.04
124 0.05
125 0.05
126 0.05
127 0.06
128 0.07
129 0.08
130 0.07
131 0.08
132 0.08
133 0.08
134 0.08
135 0.08
136 0.07
137 0.06
138 0.07
139 0.05
140 0.04
141 0.04
142 0.06
143 0.07
144 0.09
145 0.1
146 0.1
147 0.12
148 0.12
149 0.14
150 0.15
151 0.17
152 0.16
153 0.16
154 0.17
155 0.15
156 0.15
157 0.17
158 0.2
159 0.18
160 0.23
161 0.24
162 0.25
163 0.32
164 0.41
165 0.48
166 0.48
167 0.52
168 0.55
169 0.57
170 0.57
171 0.51
172 0.47
173 0.38
174 0.36
175 0.31
176 0.25
177 0.2
178 0.19
179 0.19
180 0.18
181 0.16
182 0.15
183 0.15
184 0.17
185 0.21
186 0.22
187 0.22
188 0.19
189 0.23
190 0.22
191 0.22
192 0.25
193 0.23
194 0.3
195 0.31
196 0.33
197 0.36
198 0.43
199 0.51
200 0.56
201 0.64
202 0.67
203 0.76
204 0.83
205 0.87
206 0.9
207 0.92
208 0.93
209 0.94
210 0.91
211 0.91
212 0.89
213 0.88
214 0.87
215 0.85
216 0.84
217 0.82
218 0.78
219 0.72
220 0.7
221 0.68
222 0.6
223 0.53
224 0.44
225 0.39
226 0.39
227 0.39
228 0.4
229 0.4
230 0.47
231 0.53
232 0.56
233 0.61
234 0.61
235 0.64
236 0.63
237 0.66
238 0.67
239 0.67
240 0.68
241 0.66
242 0.62
243 0.57
244 0.54
245 0.48
246 0.44