Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166AL98

Protein Details
Accession A0A166AL98   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-38GWIPAYHAKNQRCKKRHKTHRIKQHDRPRDQHBasic
NLS Segment(s)
PositionSequence
20-27KKRHKTHR
Subcellular Location(s) mito 24, nucl 2.5
Family & Domain DBs
Amino Acid Sequences MIFAGIGWIPAYHAKNQRCKKRHKTHRIKQHDRPRDQHETITGSKPGNATFPGTARYVRVVPSNSLSLRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.46
3 0.55
4 0.64
5 0.67
6 0.76
7 0.8
8 0.83
9 0.88
10 0.89
11 0.91
12 0.9
13 0.93
14 0.94
15 0.92
16 0.9
17 0.9
18 0.89
19 0.83
20 0.79
21 0.76
22 0.73
23 0.65
24 0.56
25 0.48
26 0.42
27 0.39
28 0.36
29 0.31
30 0.22
31 0.22
32 0.22
33 0.2
34 0.17
35 0.15
36 0.15
37 0.14
38 0.15
39 0.16
40 0.17
41 0.17
42 0.17
43 0.19
44 0.18
45 0.18
46 0.23
47 0.23
48 0.25
49 0.28
50 0.33