Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166C5S6

Protein Details
Accession A0A166C5S6    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
95-122ITDPTRKRGKPKGPPKPRGRPKKTVDPDBasic
NLS Segment(s)
PositionSequence
100-156RKRGKPKGPPKPRGRPKKTVDPDAPVKEKQPVGRPAKVVDPDAPVKEKRPVGRPTKA
Subcellular Location(s) cyto_nucl 13.5, cyto 13, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MRDTSPGPDSDLEYWQGDPPISGSVWDELLALEHGAPPPPAPIETSEQGGSHVASTPAHDGHSGLNTVVPASSVDVGASSSSAAVTTGTYTPIDITDPTRKRGKPKGPPKPRGRPKKTVDPDAPVKEKQPVGRPAKVVDPDAPVKEKRPVGRPTKAVDPDAPVKEKQPIGRPAKAVDPNAPVKEKQPVGRPAAARLPCKNIMMYPSDLHIKHHDVASAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.22
4 0.19
5 0.16
6 0.15
7 0.14
8 0.13
9 0.12
10 0.12
11 0.12
12 0.12
13 0.12
14 0.11
15 0.08
16 0.1
17 0.1
18 0.08
19 0.07
20 0.08
21 0.08
22 0.1
23 0.1
24 0.09
25 0.1
26 0.11
27 0.11
28 0.11
29 0.14
30 0.18
31 0.2
32 0.22
33 0.21
34 0.2
35 0.21
36 0.2
37 0.17
38 0.12
39 0.12
40 0.1
41 0.09
42 0.1
43 0.12
44 0.12
45 0.12
46 0.11
47 0.11
48 0.11
49 0.13
50 0.12
51 0.1
52 0.1
53 0.09
54 0.09
55 0.08
56 0.07
57 0.05
58 0.06
59 0.06
60 0.06
61 0.06
62 0.05
63 0.06
64 0.05
65 0.05
66 0.04
67 0.04
68 0.03
69 0.04
70 0.04
71 0.03
72 0.04
73 0.05
74 0.05
75 0.06
76 0.06
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.1
83 0.18
84 0.2
85 0.24
86 0.3
87 0.32
88 0.38
89 0.47
90 0.53
91 0.54
92 0.64
93 0.71
94 0.75
95 0.84
96 0.86
97 0.88
98 0.88
99 0.89
100 0.86
101 0.84
102 0.79
103 0.81
104 0.77
105 0.74
106 0.67
107 0.61
108 0.6
109 0.56
110 0.53
111 0.43
112 0.39
113 0.35
114 0.34
115 0.32
116 0.32
117 0.37
118 0.39
119 0.42
120 0.42
121 0.39
122 0.42
123 0.41
124 0.35
125 0.28
126 0.26
127 0.25
128 0.26
129 0.27
130 0.23
131 0.24
132 0.28
133 0.3
134 0.3
135 0.36
136 0.42
137 0.47
138 0.53
139 0.55
140 0.53
141 0.58
142 0.56
143 0.51
144 0.44
145 0.41
146 0.41
147 0.4
148 0.39
149 0.31
150 0.3
151 0.33
152 0.34
153 0.34
154 0.36
155 0.41
156 0.45
157 0.5
158 0.5
159 0.46
160 0.52
161 0.52
162 0.47
163 0.42
164 0.41
165 0.42
166 0.44
167 0.45
168 0.37
169 0.34
170 0.4
171 0.39
172 0.38
173 0.4
174 0.43
175 0.46
176 0.52
177 0.51
178 0.47
179 0.52
180 0.53
181 0.51
182 0.47
183 0.49
184 0.45
185 0.46
186 0.42
187 0.36
188 0.33
189 0.32
190 0.32
191 0.26
192 0.26
193 0.31
194 0.3
195 0.32
196 0.34
197 0.34
198 0.33
199 0.34