Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166U397

Protein Details
Accession A0A166U397    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-46MVSKIPIVKKRTKPFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
9-52KKRTKPFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQLPMPK
Subcellular Location(s) mito_nucl 12, nucl 11.5, mito 11.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSKIPIVKKRTKPFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQLPMPKIGYGSNKKTRHLLPNGLKKFLVNNVREIDLLLMHNKSFAAEIAHNVSSRNRTGILERAKVLGIKVTNAAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.91
3 0.92
4 0.91
5 0.9
6 0.9
7 0.87
8 0.85
9 0.82
10 0.74
11 0.65
12 0.59
13 0.56
14 0.54
15 0.56
16 0.57
17 0.52
18 0.5
19 0.5
20 0.55
21 0.59
22 0.59
23 0.59
24 0.61
25 0.7
26 0.78
27 0.83
28 0.76
29 0.73
30 0.71
31 0.67
32 0.67
33 0.64
34 0.64
35 0.63
36 0.65
37 0.59
38 0.52
39 0.46
40 0.37
41 0.37
42 0.33
43 0.35
44 0.4
45 0.41
46 0.42
47 0.45
48 0.47
49 0.47
50 0.45
51 0.47
52 0.45
53 0.53
54 0.54
55 0.52
56 0.48
57 0.4
58 0.37
59 0.34
60 0.34
61 0.24
62 0.26
63 0.26
64 0.27
65 0.27
66 0.26
67 0.19
68 0.13
69 0.13
70 0.1
71 0.1
72 0.09
73 0.09
74 0.09
75 0.08
76 0.08
77 0.07
78 0.09
79 0.09
80 0.11
81 0.15
82 0.16
83 0.16
84 0.17
85 0.19
86 0.2
87 0.2
88 0.2
89 0.18
90 0.18
91 0.21
92 0.29
93 0.33
94 0.33
95 0.33
96 0.33
97 0.32
98 0.31
99 0.29
100 0.26
101 0.19
102 0.17
103 0.18
104 0.19
105 0.19
106 0.2
107 0.22
108 0.19