Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165XDU5

Protein Details
Accession A0A165XDU5    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
38-81QRLRLHRKLKRTQHGKSRKPKFVGHKKRDRRRHDELTKNGKRLRBasic
NLS Segment(s)
PositionSequence
37-83EQRLRLHRKLKRTQHGKSRKPKFVGHKKRDRRRHDELTKNGKRLRLR
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
Amino Acid Sequences MYSLHFVRNLMGGSMCRKLRGSKNKMHELFASRQPGEQRLRLHRKLKRTQHGKSRKPKFVGHKKRDRRRHDELTKNGKRLRLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.22
4 0.23
5 0.28
6 0.37
7 0.46
8 0.5
9 0.53
10 0.61
11 0.69
12 0.69
13 0.65
14 0.59
15 0.54
16 0.51
17 0.48
18 0.45
19 0.35
20 0.35
21 0.34
22 0.36
23 0.33
24 0.33
25 0.32
26 0.37
27 0.45
28 0.5
29 0.57
30 0.55
31 0.62
32 0.67
33 0.71
34 0.72
35 0.72
36 0.73
37 0.75
38 0.82
39 0.82
40 0.83
41 0.83
42 0.81
43 0.77
44 0.77
45 0.77
46 0.78
47 0.79
48 0.79
49 0.81
50 0.83
51 0.9
52 0.93
53 0.91
54 0.89
55 0.87
56 0.87
57 0.87
58 0.86
59 0.86
60 0.87
61 0.86
62 0.85
63 0.79