Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5QZB5

Protein Details
Accession E5QZB5    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
88-111VGLASRRRGKERERKGRGRGRRRSBasic
NLS Segment(s)
PositionSequence
92-111SRRRGKERERKGRGRGRRRS
Subcellular Location(s) mito 15, nucl 7, cyto 5
Family & Domain DBs
Amino Acid Sequences MVKALSGQGDLGPVKMKIDGRCRVSRRGLKGIGRLGAGTHKMPLELLLGRGAIAADGVGRRMGVTWASYGSSIEASADGETRVDGLGVGLASRRRGKERERKGRGRGRRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.2
4 0.23
5 0.31
6 0.37
7 0.42
8 0.51
9 0.54
10 0.58
11 0.63
12 0.64
13 0.63
14 0.64
15 0.63
16 0.59
17 0.61
18 0.58
19 0.5
20 0.43
21 0.35
22 0.28
23 0.24
24 0.22
25 0.16
26 0.14
27 0.12
28 0.11
29 0.11
30 0.11
31 0.1
32 0.08
33 0.09
34 0.08
35 0.07
36 0.07
37 0.07
38 0.07
39 0.04
40 0.04
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.04
49 0.04
50 0.05
51 0.05
52 0.06
53 0.06
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.06
60 0.06
61 0.05
62 0.05
63 0.06
64 0.06
65 0.06
66 0.05
67 0.05
68 0.06
69 0.05
70 0.05
71 0.04
72 0.04
73 0.05
74 0.04
75 0.05
76 0.07
77 0.08
78 0.13
79 0.18
80 0.21
81 0.26
82 0.32
83 0.43
84 0.51
85 0.61
86 0.69
87 0.74
88 0.8
89 0.85
90 0.9
91 0.9