Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165WP68

Protein Details
Accession A0A165WP68   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
61-80IPEPIVKRGRREPRRTPAMLHydrophilic
NLS Segment(s)
PositionSequence
57-75KKISIPEPIVKRGRREPRR
Subcellular Location(s) nucl 9.5, cyto_nucl 8, cyto 5.5, pero 5, cysk 4
Family & Domain DBs
Amino Acid Sequences MTNQAWIAIQMLWKDEEDIEDGCSCRNCRVWDAWQYDRPIKFTISERLAKRIPALQKKISIPEPIVKRGRREPRRTPAMLCTINPPW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.13
5 0.13
6 0.13
7 0.13
8 0.13
9 0.13
10 0.16
11 0.15
12 0.16
13 0.19
14 0.2
15 0.21
16 0.26
17 0.3
18 0.35
19 0.41
20 0.43
21 0.43
22 0.45
23 0.47
24 0.44
25 0.4
26 0.33
27 0.28
28 0.25
29 0.23
30 0.26
31 0.25
32 0.3
33 0.29
34 0.32
35 0.32
36 0.3
37 0.29
38 0.28
39 0.32
40 0.35
41 0.4
42 0.39
43 0.43
44 0.45
45 0.48
46 0.46
47 0.4
48 0.34
49 0.35
50 0.36
51 0.39
52 0.45
53 0.43
54 0.46
55 0.53
56 0.62
57 0.65
58 0.7
59 0.73
60 0.75
61 0.81
62 0.79
63 0.73
64 0.7
65 0.69
66 0.63
67 0.54