Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166NN31

Protein Details
Accession A0A166NN31    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
185-204APKMVKRAGGKKPKRVSAPAHydrophilic
NLS Segment(s)
PositionSequence
186-199PKMVKRAGGKKPKR
Subcellular Location(s) mito 19, cyto_mito 13.333, cyto 5.5, cyto_nucl 4.666
Family & Domain DBs
Amino Acid Sequences MPKSASKVAPAVAAPKTPVERTRSNDWASLSATAPEPVVTSPAVGSELSSSKDTFPLQDLAAKDKADVITPSFEMSTPAEEVPQTEKSLFSAPLPPGESSSSWGNKISGFAAPVKPFGFGRLSGRGTPAAAAPEKASSGWGLGSFDVKDSSAGAGAGGGYAGGGGASEPAPLAEKPKDEEEGWGAPKMVKRAGGKKPKRVSAPALDLPCT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.26
4 0.27
5 0.32
6 0.34
7 0.38
8 0.43
9 0.5
10 0.52
11 0.52
12 0.51
13 0.48
14 0.44
15 0.39
16 0.35
17 0.27
18 0.22
19 0.2
20 0.17
21 0.15
22 0.12
23 0.11
24 0.09
25 0.1
26 0.08
27 0.08
28 0.07
29 0.08
30 0.09
31 0.08
32 0.08
33 0.09
34 0.1
35 0.12
36 0.13
37 0.14
38 0.13
39 0.16
40 0.16
41 0.15
42 0.16
43 0.16
44 0.15
45 0.18
46 0.18
47 0.2
48 0.22
49 0.21
50 0.19
51 0.19
52 0.19
53 0.16
54 0.16
55 0.13
56 0.13
57 0.13
58 0.13
59 0.11
60 0.11
61 0.11
62 0.11
63 0.11
64 0.1
65 0.1
66 0.1
67 0.1
68 0.11
69 0.12
70 0.14
71 0.13
72 0.12
73 0.12
74 0.13
75 0.15
76 0.14
77 0.12
78 0.15
79 0.14
80 0.16
81 0.18
82 0.17
83 0.16
84 0.17
85 0.16
86 0.14
87 0.18
88 0.16
89 0.15
90 0.16
91 0.15
92 0.14
93 0.14
94 0.12
95 0.09
96 0.09
97 0.1
98 0.12
99 0.12
100 0.14
101 0.13
102 0.13
103 0.13
104 0.14
105 0.13
106 0.11
107 0.14
108 0.18
109 0.2
110 0.19
111 0.21
112 0.19
113 0.18
114 0.17
115 0.14
116 0.12
117 0.11
118 0.11
119 0.1
120 0.1
121 0.1
122 0.1
123 0.09
124 0.07
125 0.07
126 0.07
127 0.07
128 0.07
129 0.07
130 0.08
131 0.08
132 0.08
133 0.08
134 0.08
135 0.08
136 0.08
137 0.08
138 0.07
139 0.06
140 0.06
141 0.05
142 0.05
143 0.04
144 0.04
145 0.03
146 0.02
147 0.02
148 0.02
149 0.02
150 0.02
151 0.02
152 0.03
153 0.03
154 0.04
155 0.04
156 0.04
157 0.07
158 0.07
159 0.12
160 0.14
161 0.16
162 0.19
163 0.23
164 0.26
165 0.24
166 0.27
167 0.27
168 0.3
169 0.3
170 0.28
171 0.26
172 0.25
173 0.28
174 0.28
175 0.26
176 0.27
177 0.32
178 0.4
179 0.5
180 0.58
181 0.64
182 0.71
183 0.78
184 0.8
185 0.8
186 0.77
187 0.75
188 0.73
189 0.73
190 0.7