Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166JUR8

Protein Details
Accession A0A166JUR8    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
61-86AYLWSPARTRRPRRVRSVPKPQARLHHydrophilic
NLS Segment(s)
PositionSequence
68-82RTRRPRRVRSVPKPQ
Subcellular Location(s) mito 14, extr 5, nucl 4, cyto 2
Family & Domain DBs
Amino Acid Sequences MYAATTWLAMSQPRVLAAPLLLRAPLTPTHRDPVTPAPTTQDRHTPTPQDRRTLTPRAATAYLWSPARTRRPRRVRSVPKPQARLHPRALDIPTPTPTHQVRVQDRGPTLRAHHIPTPRAVTAGLPPLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.14
4 0.14
5 0.14
6 0.13
7 0.13
8 0.12
9 0.11
10 0.11
11 0.13
12 0.17
13 0.19
14 0.23
15 0.25
16 0.3
17 0.31
18 0.31
19 0.32
20 0.36
21 0.37
22 0.34
23 0.31
24 0.31
25 0.35
26 0.38
27 0.36
28 0.35
29 0.33
30 0.37
31 0.4
32 0.42
33 0.45
34 0.53
35 0.54
36 0.52
37 0.5
38 0.51
39 0.53
40 0.52
41 0.46
42 0.39
43 0.37
44 0.34
45 0.33
46 0.26
47 0.22
48 0.18
49 0.18
50 0.15
51 0.15
52 0.13
53 0.17
54 0.27
55 0.34
56 0.4
57 0.49
58 0.59
59 0.66
60 0.74
61 0.81
62 0.82
63 0.83
64 0.87
65 0.86
66 0.83
67 0.82
68 0.76
69 0.75
70 0.71
71 0.67
72 0.61
73 0.56
74 0.5
75 0.48
76 0.47
77 0.4
78 0.36
79 0.33
80 0.31
81 0.29
82 0.28
83 0.29
84 0.28
85 0.29
86 0.29
87 0.35
88 0.38
89 0.42
90 0.44
91 0.44
92 0.46
93 0.46
94 0.44
95 0.38
96 0.36
97 0.38
98 0.38
99 0.38
100 0.41
101 0.44
102 0.45
103 0.47
104 0.49
105 0.41
106 0.38
107 0.34
108 0.29
109 0.27