Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166X984

Protein Details
Accession A0A166X984    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
75-101RGTEYQPSQRKRKRKHGFLARKRTPGGBasic
NLS Segment(s)
PositionSequence
83-113QRKRKRKHGFLARKRTPGGRKVLARRFAKGR
Subcellular Location(s) mito 16, nucl 8, cyto 1, plas 1, pero 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRIPRPLLQLLSRTPRLQPLQSIVSQVVRPIAPTLFASPALHALPAISSLTFATPSWTSSPILSALQQTRFKARGTEYQPSQRKRKRKHGFLARKRTPGGRKVLARRFAKGRLFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.4
3 0.44
4 0.45
5 0.42
6 0.39
7 0.36
8 0.37
9 0.36
10 0.37
11 0.3
12 0.28
13 0.25
14 0.22
15 0.19
16 0.15
17 0.14
18 0.14
19 0.12
20 0.11
21 0.12
22 0.13
23 0.12
24 0.13
25 0.13
26 0.11
27 0.13
28 0.12
29 0.11
30 0.09
31 0.07
32 0.06
33 0.07
34 0.07
35 0.04
36 0.05
37 0.05
38 0.05
39 0.06
40 0.06
41 0.07
42 0.07
43 0.09
44 0.1
45 0.11
46 0.11
47 0.11
48 0.12
49 0.1
50 0.11
51 0.1
52 0.12
53 0.13
54 0.19
55 0.21
56 0.22
57 0.25
58 0.26
59 0.26
60 0.25
61 0.26
62 0.29
63 0.32
64 0.39
65 0.39
66 0.47
67 0.55
68 0.59
69 0.66
70 0.66
71 0.7
72 0.72
73 0.79
74 0.8
75 0.82
76 0.87
77 0.87
78 0.91
79 0.91
80 0.93
81 0.9
82 0.85
83 0.78
84 0.76
85 0.72
86 0.68
87 0.65
88 0.63
89 0.63
90 0.67
91 0.73
92 0.74
93 0.7
94 0.69
95 0.66
96 0.66
97 0.64
98 0.6