Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166MSG1

Protein Details
Accession A0A166MSG1    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
41-60SPEVPKPRCSKNSRGTKMRGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 13.833, cyto 6.5, cyto_mito 4.832
Family & Domain DBs
Amino Acid Sequences ISTVSAGTHDISDGVFRRIVSPEGERGICPMRPRPRQRALSPEVPKPRCSKNSRGTKMRGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.13
4 0.14
5 0.16
6 0.17
7 0.17
8 0.17
9 0.18
10 0.2
11 0.2
12 0.19
13 0.19
14 0.2
15 0.19
16 0.19
17 0.24
18 0.3
19 0.39
20 0.46
21 0.52
22 0.59
23 0.65
24 0.67
25 0.68
26 0.65
27 0.66
28 0.63
29 0.63
30 0.64
31 0.59
32 0.59
33 0.55
34 0.58
35 0.57
36 0.6
37 0.62
38 0.62
39 0.71
40 0.76
41 0.8