Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165YKT4

Protein Details
Accession A0A165YKT4   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
101-129AEVIKHKRCHTDRRTRRDHTENQNRAFRLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MKRASGSSRRVQVINTSQVDLKSSVLTHKALQGQKKINVNRGWEHLQQMSEEELELHNQQVMDAQNTMVVDQDIEMQYNEVLLGRLPLDISNAGGKMAAVAEVIKHKRCHTDRRTRRDHTENQNRAFRLQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.44
3 0.39
4 0.37
5 0.37
6 0.38
7 0.3
8 0.23
9 0.16
10 0.15
11 0.16
12 0.17
13 0.18
14 0.17
15 0.2
16 0.27
17 0.3
18 0.35
19 0.4
20 0.43
21 0.47
22 0.54
23 0.53
24 0.54
25 0.54
26 0.52
27 0.48
28 0.47
29 0.46
30 0.4
31 0.39
32 0.33
33 0.29
34 0.25
35 0.23
36 0.19
37 0.13
38 0.11
39 0.09
40 0.07
41 0.08
42 0.08
43 0.07
44 0.07
45 0.07
46 0.07
47 0.09
48 0.1
49 0.09
50 0.09
51 0.09
52 0.09
53 0.09
54 0.09
55 0.06
56 0.05
57 0.04
58 0.04
59 0.06
60 0.05
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.05
73 0.05
74 0.05
75 0.06
76 0.06
77 0.07
78 0.08
79 0.08
80 0.08
81 0.08
82 0.07
83 0.06
84 0.06
85 0.05
86 0.04
87 0.04
88 0.05
89 0.13
90 0.17
91 0.22
92 0.24
93 0.27
94 0.37
95 0.43
96 0.52
97 0.56
98 0.63
99 0.69
100 0.77
101 0.85
102 0.82
103 0.86
104 0.84
105 0.84
106 0.83
107 0.84
108 0.83
109 0.81
110 0.81
111 0.73