Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4UX10

Protein Details
Accession E4UX10    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
61-87PSSSHLQAERKTKKKREKSSSSTNSPDHydrophilic
NLS Segment(s)
PositionSequence
70-78RKTKKKREK
Subcellular Location(s) nucl 13, cyto_nucl 11.5, cyto 8, mito 5
Family & Domain DBs
Amino Acid Sequences MAEANPGWEGPGHFWGRGRNILRKRILPPQSVPSVEDACQYSLACRVLDLIPATRIWGEGPSSSHLQAERKTKKKREKSSSSTNSPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.3
4 0.37
5 0.38
6 0.41
7 0.46
8 0.54
9 0.56
10 0.56
11 0.57
12 0.58
13 0.6
14 0.55
15 0.51
16 0.48
17 0.48
18 0.44
19 0.4
20 0.33
21 0.29
22 0.24
23 0.23
24 0.18
25 0.14
26 0.14
27 0.13
28 0.1
29 0.11
30 0.12
31 0.1
32 0.09
33 0.1
34 0.09
35 0.11
36 0.12
37 0.1
38 0.1
39 0.1
40 0.11
41 0.09
42 0.09
43 0.08
44 0.08
45 0.08
46 0.09
47 0.11
48 0.14
49 0.16
50 0.16
51 0.17
52 0.18
53 0.21
54 0.26
55 0.34
56 0.41
57 0.49
58 0.59
59 0.67
60 0.76
61 0.83
62 0.88
63 0.88
64 0.89
65 0.88
66 0.89
67 0.89