Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166RQY3

Protein Details
Accession A0A166RQY3    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
85-106GHPAQNERRDSRRKRRGDRKVFBasic
NLS Segment(s)
PositionSequence
92-104RRDSRRKRRGDRK
Subcellular Location(s) mito 14, cyto 7.5, cyto_nucl 7, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013815  ATP_grasp_subdomain_1  
Gene Ontology GO:0005524  F:ATP binding  
Amino Acid Sequences MVSLGRISYSPLIFRPQHLDDQMSHAPPPKLCASRGTRCSPATWPSRRVLAASGTHVNSAADIRAFVEGGVRYPVMIKALDGGGGHPAQNERRDSRRKRRGDRKVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.31
3 0.3
4 0.35
5 0.34
6 0.35
7 0.29
8 0.35
9 0.37
10 0.31
11 0.29
12 0.28
13 0.29
14 0.26
15 0.3
16 0.29
17 0.27
18 0.27
19 0.34
20 0.36
21 0.42
22 0.48
23 0.49
24 0.47
25 0.45
26 0.47
27 0.42
28 0.41
29 0.41
30 0.4
31 0.39
32 0.36
33 0.38
34 0.36
35 0.33
36 0.28
37 0.23
38 0.19
39 0.18
40 0.19
41 0.17
42 0.16
43 0.16
44 0.14
45 0.11
46 0.1
47 0.07
48 0.05
49 0.04
50 0.05
51 0.05
52 0.05
53 0.05
54 0.07
55 0.07
56 0.08
57 0.09
58 0.08
59 0.08
60 0.09
61 0.1
62 0.09
63 0.09
64 0.08
65 0.08
66 0.08
67 0.09
68 0.09
69 0.09
70 0.1
71 0.11
72 0.11
73 0.1
74 0.14
75 0.17
76 0.23
77 0.28
78 0.3
79 0.39
80 0.5
81 0.59
82 0.67
83 0.73
84 0.79
85 0.85
86 0.9