Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166Q261

Protein Details
Accession A0A166Q261    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
42-69QSKRRTGDTVRGRRRRRRRHVVLVLGVFBasic
NLS Segment(s)
PositionSequence
49-60DTVRGRRRRRRR
Subcellular Location(s) extr 9, cyto 8, cyto_nucl 8, nucl 6, mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYACGAKLSGSLDVQAVALSFVPDVFLSSSSDLGLVNRLGDQSKRRTGDTVRGRRRRRRRHVVLVLGVFVLYFRVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.08
4 0.06
5 0.06
6 0.05
7 0.05
8 0.04
9 0.05
10 0.05
11 0.05
12 0.06
13 0.06
14 0.08
15 0.08
16 0.09
17 0.08
18 0.08
19 0.07
20 0.07
21 0.08
22 0.06
23 0.06
24 0.06
25 0.06
26 0.07
27 0.09
28 0.13
29 0.18
30 0.24
31 0.26
32 0.27
33 0.29
34 0.31
35 0.39
36 0.46
37 0.51
38 0.55
39 0.63
40 0.72
41 0.79
42 0.88
43 0.89
44 0.89
45 0.9
46 0.89
47 0.91
48 0.91
49 0.89
50 0.86
51 0.76
52 0.66
53 0.55
54 0.44
55 0.33
56 0.23