Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165XXD0

Protein Details
Accession A0A165XXD0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
25-44AMVTKTRKDKHKSRKGKDVGBasic
NLS Segment(s)
PositionSequence
31-40RKDKHKSRKG
Subcellular Location(s) cyto 26
Family & Domain DBs
Amino Acid Sequences MHEADSTVTTAELEYEVVDLEGLLAMVTKTRKDKHKSRKGKDVGEDCRYVCGFGSGDGEAEAAGDEDQPPLCVVWNFFAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.05
5 0.05
6 0.04
7 0.04
8 0.04
9 0.03
10 0.03
11 0.03
12 0.03
13 0.05
14 0.06
15 0.09
16 0.13
17 0.19
18 0.27
19 0.35
20 0.45
21 0.54
22 0.65
23 0.73
24 0.75
25 0.81
26 0.79
27 0.77
28 0.74
29 0.71
30 0.67
31 0.6
32 0.55
33 0.45
34 0.41
35 0.35
36 0.28
37 0.19
38 0.15
39 0.11
40 0.1
41 0.12
42 0.09
43 0.09
44 0.09
45 0.09
46 0.07
47 0.07
48 0.06
49 0.04
50 0.04
51 0.04
52 0.05
53 0.06
54 0.07
55 0.07
56 0.08
57 0.07
58 0.09
59 0.1
60 0.12