Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166KWY6

Protein Details
Accession A0A166KWY6    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
138-166SSGSSFWRNPFKKRPKRVTFTPARRGFRVHydrophilic
NLS Segment(s)
PositionSequence
149-153KKRPK
Subcellular Location(s) mito 14, nucl 7.5, cyto_nucl 6, cyto 3.5
Family & Domain DBs
Amino Acid Sequences ACFMLVLWWYRRYMRMKYGTKSVDQRNILPWFRMLRIWPNSADSSATAVVGSGGSTWMIDDFESAMMHQVRLSPDSDEDPNFHFDALSPAHSFPFSDRASAPQLFNPAHANGQHVRPLGKARKDSGSPTRVPFSTSSSSGSSFWRNPFKKRPKRVTFTPARRGFRVDETDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.51
3 0.56
4 0.58
5 0.66
6 0.62
7 0.63
8 0.65
9 0.63
10 0.62
11 0.57
12 0.55
13 0.52
14 0.56
15 0.51
16 0.44
17 0.4
18 0.35
19 0.33
20 0.33
21 0.28
22 0.3
23 0.33
24 0.35
25 0.32
26 0.33
27 0.33
28 0.31
29 0.3
30 0.21
31 0.19
32 0.16
33 0.15
34 0.1
35 0.09
36 0.08
37 0.07
38 0.07
39 0.04
40 0.04
41 0.03
42 0.03
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.05
52 0.08
53 0.08
54 0.08
55 0.08
56 0.1
57 0.1
58 0.12
59 0.13
60 0.1
61 0.11
62 0.13
63 0.15
64 0.13
65 0.13
66 0.14
67 0.16
68 0.15
69 0.14
70 0.11
71 0.1
72 0.12
73 0.11
74 0.11
75 0.1
76 0.1
77 0.1
78 0.1
79 0.1
80 0.09
81 0.15
82 0.13
83 0.14
84 0.14
85 0.16
86 0.21
87 0.22
88 0.22
89 0.17
90 0.21
91 0.19
92 0.2
93 0.2
94 0.16
95 0.17
96 0.16
97 0.18
98 0.16
99 0.18
100 0.21
101 0.19
102 0.19
103 0.19
104 0.27
105 0.31
106 0.35
107 0.37
108 0.36
109 0.4
110 0.42
111 0.47
112 0.47
113 0.46
114 0.43
115 0.43
116 0.44
117 0.39
118 0.39
119 0.34
120 0.32
121 0.3
122 0.28
123 0.28
124 0.25
125 0.27
126 0.26
127 0.28
128 0.27
129 0.27
130 0.32
131 0.4
132 0.42
133 0.49
134 0.59
135 0.67
136 0.72
137 0.79
138 0.83
139 0.83
140 0.88
141 0.89
142 0.88
143 0.88
144 0.88
145 0.88
146 0.86
147 0.81
148 0.75
149 0.7
150 0.64
151 0.61