Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165Z8Q0

Protein Details
Accession A0A165Z8Q0    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
70-95LLSPLRNTRKVRPKPRPRPAPAHIYAHydrophilic
NLS Segment(s)
PositionSequence
78-88RKVRPKPRPRP
Subcellular Location(s) nucl 13.5, mito 9, cyto_nucl 9, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSDLSALIAPQLLPHGMTCGMSTRRVPSPTGRPIMVTRQPAANEPSSSSTGSSSALTSPISTKTELDSGLLSPLRNTRKVRPKPRPRPAPAHIYAPTPYIHPNPHNPSHI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.1
4 0.1
5 0.1
6 0.15
7 0.17
8 0.19
9 0.2
10 0.22
11 0.28
12 0.29
13 0.31
14 0.31
15 0.38
16 0.43
17 0.45
18 0.41
19 0.38
20 0.38
21 0.44
22 0.43
23 0.37
24 0.31
25 0.3
26 0.3
27 0.31
28 0.31
29 0.26
30 0.21
31 0.19
32 0.21
33 0.2
34 0.19
35 0.17
36 0.14
37 0.12
38 0.13
39 0.12
40 0.09
41 0.07
42 0.08
43 0.07
44 0.07
45 0.08
46 0.09
47 0.1
48 0.1
49 0.1
50 0.11
51 0.12
52 0.12
53 0.12
54 0.1
55 0.09
56 0.11
57 0.12
58 0.11
59 0.1
60 0.17
61 0.2
62 0.26
63 0.29
64 0.36
65 0.46
66 0.57
67 0.67
68 0.72
69 0.8
70 0.85
71 0.92
72 0.93
73 0.9
74 0.89
75 0.83
76 0.82
77 0.73
78 0.69
79 0.6
80 0.52
81 0.46
82 0.38
83 0.33
84 0.25
85 0.26
86 0.23
87 0.28
88 0.3
89 0.39
90 0.45