Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165ZAF0

Protein Details
Accession A0A165ZAF0    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
51-70TGRPGARKARRKQKSARIGFBasic
NLS Segment(s)
PositionSequence
53-71RPGARKARRKQKSARIGFG
Subcellular Location(s) nucl 15, cyto 9.5, cyto_pero 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002132  Ribosomal_L5  
IPR031309  Ribosomal_L5_C  
IPR022803  Ribosomal_L5_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00673  Ribosomal_L5_C  
Amino Acid Sequences LERGLKVKEYELSRDFSETGNFGYCVQEHIDLGARYDQGISIFGMDFYVVTGRPGARKARRKQKSARIGFGDRMKKHVTQSWLKHWRFDDIIMVSSIFVLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.27
4 0.25
5 0.19
6 0.18
7 0.16
8 0.15
9 0.14
10 0.14
11 0.13
12 0.13
13 0.14
14 0.13
15 0.11
16 0.11
17 0.15
18 0.14
19 0.15
20 0.15
21 0.13
22 0.13
23 0.13
24 0.12
25 0.08
26 0.09
27 0.07
28 0.06
29 0.06
30 0.06
31 0.06
32 0.05
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.05
39 0.05
40 0.07
41 0.1
42 0.17
43 0.25
44 0.35
45 0.44
46 0.54
47 0.62
48 0.68
49 0.75
50 0.78
51 0.8
52 0.77
53 0.75
54 0.71
55 0.66
56 0.64
57 0.63
58 0.61
59 0.51
60 0.49
61 0.46
62 0.42
63 0.42
64 0.42
65 0.41
66 0.41
67 0.47
68 0.53
69 0.61
70 0.59
71 0.61
72 0.57
73 0.56
74 0.49
75 0.43
76 0.39
77 0.31
78 0.32
79 0.27
80 0.26
81 0.19