Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165YLJ4

Protein Details
Accession A0A165YLJ4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
48-79LTPHSRVPRHRLPPHRRLRHGRQHLSRNIRSQBasic
NLS Segment(s)
PositionSequence
55-69PRHRLPPHRRLRHGR
Subcellular Location(s) extr 12, plas 10, mito 2, cyto 1, E.R. 1, vacu 1, mito_nucl 1
Family & Domain DBs
Amino Acid Sequences MGQVGCILVPIGLFALACTTYASVRGSSQIPMIASIPGRFGAGIYFALTPHSRVPRHRLPPHRRLRHGRQHLSRNIRSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.05
4 0.06
5 0.06
6 0.07
7 0.07
8 0.09
9 0.1
10 0.09
11 0.1
12 0.12
13 0.12
14 0.12
15 0.13
16 0.12
17 0.11
18 0.11
19 0.11
20 0.1
21 0.1
22 0.09
23 0.09
24 0.08
25 0.08
26 0.07
27 0.06
28 0.05
29 0.05
30 0.05
31 0.06
32 0.06
33 0.06
34 0.08
35 0.09
36 0.1
37 0.14
38 0.2
39 0.21
40 0.25
41 0.33
42 0.41
43 0.51
44 0.59
45 0.65
46 0.68
47 0.77
48 0.84
49 0.86
50 0.86
51 0.86
52 0.87
53 0.87
54 0.89
55 0.89
56 0.87
57 0.87
58 0.87
59 0.88