Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167U0D4

Protein Details
Accession A0A167U0D4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
12-36TLMAMVKRRKSWRRHPSTRGTPFNTHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, mito 6, extr 4, E.R. 3, mito_nucl 3
Family & Domain DBs
Amino Acid Sequences MSTMILVLVLETLMAMVKRRKSWRRHPSTRGTPFNTNDTILLLYFFQACRTPSSLVIVSLSTTYTFSLYIFFSFPLLARMCCPLSLALFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.08
3 0.13
4 0.18
5 0.25
6 0.35
7 0.44
8 0.52
9 0.63
10 0.71
11 0.77
12 0.83
13 0.84
14 0.85
15 0.87
16 0.87
17 0.84
18 0.78
19 0.74
20 0.66
21 0.62
22 0.52
23 0.42
24 0.32
25 0.25
26 0.2
27 0.14
28 0.12
29 0.07
30 0.06
31 0.06
32 0.06
33 0.06
34 0.07
35 0.08
36 0.1
37 0.12
38 0.13
39 0.13
40 0.17
41 0.17
42 0.16
43 0.16
44 0.13
45 0.11
46 0.1
47 0.1
48 0.07
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.08
55 0.08
56 0.09
57 0.09
58 0.09
59 0.09
60 0.09
61 0.09
62 0.12
63 0.13
64 0.13
65 0.13
66 0.18
67 0.18
68 0.18
69 0.19
70 0.16