Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166LNR9

Protein Details
Accession A0A166LNR9    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
60-82RPPLHPRLRVRQPWRGERRRAHHBasic
NLS Segment(s)
PositionSequence
64-82HPRLRVRQPWRGERRRAHH
Subcellular Location(s) nucl 10.5, cyto_nucl 7.333, extr 7, mito 5.5, cyto_mito 4.833, cyto 3
Family & Domain DBs
Amino Acid Sequences MDRREFNSPAAAASLAEQGVGTIFGAAYWTGCNSESPNSNPQQDQTPQPSTRLRDFLSPRPPLHPRLRVRQPWRGERRRAHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.1
3 0.09
4 0.08
5 0.07
6 0.07
7 0.07
8 0.05
9 0.03
10 0.03
11 0.03
12 0.04
13 0.04
14 0.04
15 0.04
16 0.05
17 0.05
18 0.06
19 0.07
20 0.08
21 0.1
22 0.13
23 0.16
24 0.21
25 0.23
26 0.24
27 0.24
28 0.23
29 0.26
30 0.25
31 0.26
32 0.26
33 0.3
34 0.29
35 0.33
36 0.36
37 0.35
38 0.37
39 0.37
40 0.32
41 0.34
42 0.38
43 0.43
44 0.47
45 0.49
46 0.47
47 0.49
48 0.52
49 0.52
50 0.56
51 0.57
52 0.55
53 0.59
54 0.69
55 0.72
56 0.76
57 0.78
58 0.78
59 0.79
60 0.84
61 0.83
62 0.83