Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166CMW4

Protein Details
Accession A0A166CMW4    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
80-109QDKKARGKGVPKKAKSKDDSRRTNRKKKTSBasic
NLS Segment(s)
PositionSequence
82-109KKARGKGVPKKAKSKDDSRRTNRKKKTS
Subcellular Location(s) mito 17, nucl 8.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSAVTPSRLSAINRIRCSIFQTSYNPTSVRTGAKYLRARLRGPSMVGYYPQAPTISSLIRQYPEIGWVNHPEVQRLQDVQDKKARGKGVPKKAKSKDDSRRTNRKKKTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.43
4 0.47
5 0.43
6 0.36
7 0.31
8 0.33
9 0.38
10 0.38
11 0.39
12 0.34
13 0.3
14 0.3
15 0.28
16 0.26
17 0.21
18 0.24
19 0.24
20 0.33
21 0.36
22 0.39
23 0.44
24 0.45
25 0.44
26 0.44
27 0.47
28 0.39
29 0.36
30 0.32
31 0.27
32 0.24
33 0.23
34 0.2
35 0.15
36 0.14
37 0.13
38 0.11
39 0.09
40 0.1
41 0.1
42 0.1
43 0.1
44 0.11
45 0.11
46 0.12
47 0.12
48 0.12
49 0.1
50 0.15
51 0.16
52 0.16
53 0.16
54 0.18
55 0.21
56 0.24
57 0.23
58 0.2
59 0.19
60 0.21
61 0.21
62 0.19
63 0.19
64 0.21
65 0.23
66 0.26
67 0.31
68 0.32
69 0.32
70 0.37
71 0.37
72 0.35
73 0.44
74 0.49
75 0.54
76 0.62
77 0.67
78 0.72
79 0.78
80 0.83
81 0.8
82 0.8
83 0.8
84 0.8
85 0.84
86 0.84
87 0.87
88 0.88
89 0.92