Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4V0D7

Protein Details
Accession E4V0D7    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MATKLRFVRKKQRLKAEDAEHydrophilic
NLS Segment(s)
PositionSequence
40-63GRRSVKRKEEKKGEGEGDRERRSK
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MATKLRFVRKKQRLKAEDAEAEEAEDEGKSKTPLSSHVAGRRSVKRKEEKKGEGEGDRERRSKAGEPSQQAPSPYHNLMQLKWRRSSRDDGPDHAGRRNGQHSPYTFMQTTPGRGTGYWGLGGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.77
4 0.72
5 0.64
6 0.58
7 0.47
8 0.42
9 0.33
10 0.25
11 0.17
12 0.12
13 0.09
14 0.06
15 0.08
16 0.08
17 0.09
18 0.1
19 0.1
20 0.15
21 0.2
22 0.24
23 0.28
24 0.34
25 0.36
26 0.37
27 0.43
28 0.48
29 0.49
30 0.5
31 0.54
32 0.57
33 0.63
34 0.69
35 0.73
36 0.7
37 0.68
38 0.68
39 0.63
40 0.56
41 0.52
42 0.49
43 0.46
44 0.44
45 0.4
46 0.35
47 0.31
48 0.31
49 0.33
50 0.31
51 0.33
52 0.35
53 0.37
54 0.4
55 0.43
56 0.42
57 0.38
58 0.33
59 0.28
60 0.26
61 0.24
62 0.22
63 0.22
64 0.22
65 0.22
66 0.3
67 0.33
68 0.33
69 0.39
70 0.41
71 0.42
72 0.45
73 0.51
74 0.5
75 0.53
76 0.52
77 0.5
78 0.53
79 0.54
80 0.52
81 0.49
82 0.44
83 0.35
84 0.38
85 0.39
86 0.36
87 0.33
88 0.38
89 0.36
90 0.39
91 0.4
92 0.41
93 0.36
94 0.32
95 0.36
96 0.32
97 0.34
98 0.3
99 0.3
100 0.26
101 0.25
102 0.3
103 0.27
104 0.27