Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166EU57

Protein Details
Accession A0A166EU57    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
34-66ATWHFSRKGRSRPHLRHRNRRRLQQRHGRVGVCBasic
NLS Segment(s)
PositionSequence
40-58RKGRSRPHLRHRNRRRLQQ
Subcellular Location(s) mito 13, nucl 9.5, cyto_nucl 6, plas 3
Family & Domain DBs
Amino Acid Sequences MGSNSSCTMGRPHQFHPLPRPSYHFLRVPSSVIATWHFSRKGRSRPHLRHRNRRRLQQRHGRVGVCVRHGESVDLRIRAGACMCYGVLLGKRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.53
3 0.57
4 0.59
5 0.57
6 0.54
7 0.58
8 0.53
9 0.54
10 0.53
11 0.48
12 0.41
13 0.41
14 0.4
15 0.36
16 0.31
17 0.27
18 0.22
19 0.19
20 0.18
21 0.17
22 0.17
23 0.19
24 0.21
25 0.2
26 0.27
27 0.33
28 0.4
29 0.44
30 0.52
31 0.59
32 0.67
33 0.76
34 0.81
35 0.83
36 0.86
37 0.88
38 0.9
39 0.87
40 0.87
41 0.87
42 0.86
43 0.87
44 0.87
45 0.85
46 0.83
47 0.81
48 0.71
49 0.63
50 0.59
51 0.53
52 0.45
53 0.37
54 0.29
55 0.26
56 0.25
57 0.25
58 0.2
59 0.23
60 0.24
61 0.23
62 0.22
63 0.22
64 0.22
65 0.21
66 0.21
67 0.15
68 0.11
69 0.12
70 0.12
71 0.11
72 0.1
73 0.12