Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167SN00

Protein Details
Accession A0A167SN00    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
67-99VHPVRPAHQQRPRRPRHRNRRNRRRQEEQDVEDBasic
NLS Segment(s)
PositionSequence
73-91AHQQRPRRPRHRNRRNRRR
Subcellular Location(s) nucl 8.5, cyto_nucl 8.5, cyto 5.5, extr 5, mito 3, plas 3
Family & Domain DBs
Amino Acid Sequences MLSVIEIAAISSALLYFLPITTATRLRPGLIQRIFQIGPIGPGAHEFELRHTSRIPQHIPPTPLRNVHPVRPAHQQRPRRPRHRNRRNRRRQEEQDVEDLVTPPPAPPYQAQENPIVHPNPPPALPRFREPSIVILDRDPSIQTIEDHPSIFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.06
6 0.06
7 0.08
8 0.11
9 0.15
10 0.15
11 0.2
12 0.21
13 0.21
14 0.25
15 0.28
16 0.34
17 0.34
18 0.35
19 0.31
20 0.36
21 0.35
22 0.3
23 0.28
24 0.19
25 0.17
26 0.16
27 0.14
28 0.09
29 0.1
30 0.12
31 0.1
32 0.12
33 0.1
34 0.13
35 0.2
36 0.21
37 0.21
38 0.19
39 0.23
40 0.26
41 0.32
42 0.33
43 0.31
44 0.36
45 0.4
46 0.43
47 0.43
48 0.43
49 0.41
50 0.4
51 0.37
52 0.4
53 0.37
54 0.38
55 0.41
56 0.37
57 0.37
58 0.44
59 0.47
60 0.47
61 0.53
62 0.58
63 0.61
64 0.7
65 0.77
66 0.77
67 0.83
68 0.85
69 0.88
70 0.9
71 0.92
72 0.93
73 0.94
74 0.96
75 0.96
76 0.93
77 0.92
78 0.89
79 0.89
80 0.85
81 0.77
82 0.7
83 0.59
84 0.51
85 0.42
86 0.34
87 0.23
88 0.15
89 0.12
90 0.08
91 0.1
92 0.09
93 0.1
94 0.11
95 0.17
96 0.24
97 0.27
98 0.3
99 0.33
100 0.35
101 0.35
102 0.39
103 0.34
104 0.27
105 0.27
106 0.28
107 0.24
108 0.24
109 0.25
110 0.25
111 0.32
112 0.35
113 0.38
114 0.41
115 0.41
116 0.44
117 0.41
118 0.41
119 0.4
120 0.4
121 0.35
122 0.3
123 0.31
124 0.27
125 0.26
126 0.22
127 0.16
128 0.15
129 0.15
130 0.15
131 0.17
132 0.22
133 0.23