Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167WN13

Protein Details
Accession A0A167WN13   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MDANFRLKSRDRKIKGDKVLGPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto_nucl 8.833, nucl 8.5, cyto 8, cyto_pero 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR040521  KDZ  
Pfam View protein in Pfam  
PF18758  KDZ  
Amino Acid Sequences MDANFRLKSRDRKIKGDKVLGPGWDYFVDYQRYRPIMDTFGAQMEPNTCDSGLHAVDHANTRFARNNLANSVGNIVCARHTFVRKTGTVNLDKGEKYEHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.8
4 0.74
5 0.69
6 0.67
7 0.57
8 0.49
9 0.39
10 0.33
11 0.25
12 0.21
13 0.16
14 0.17
15 0.21
16 0.19
17 0.21
18 0.24
19 0.25
20 0.24
21 0.26
22 0.23
23 0.2
24 0.2
25 0.19
26 0.15
27 0.14
28 0.14
29 0.12
30 0.1
31 0.09
32 0.1
33 0.09
34 0.09
35 0.08
36 0.08
37 0.08
38 0.1
39 0.09
40 0.08
41 0.07
42 0.07
43 0.08
44 0.12
45 0.12
46 0.12
47 0.12
48 0.14
49 0.18
50 0.18
51 0.23
52 0.23
53 0.25
54 0.24
55 0.28
56 0.26
57 0.23
58 0.26
59 0.19
60 0.18
61 0.15
62 0.14
63 0.11
64 0.12
65 0.14
66 0.16
67 0.21
68 0.23
69 0.28
70 0.34
71 0.34
72 0.38
73 0.42
74 0.44
75 0.45
76 0.44
77 0.41
78 0.4
79 0.39
80 0.36