Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166LJD1

Protein Details
Accession A0A166LJD1    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
53-77VAANVAKTKRKRPRQAGCRPSGKKEHydrophilic
NLS Segment(s)
PositionSequence
59-78KTKRKRPRQAGCRPSGKKEK
Subcellular Location(s) cyto 16, nucl 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MGGVSAQKPRRVLDRGVEVLVATPGRLWGILEDDDELANAENIETKFEDLADVAANVAKTKRKRPRQAGCRPSGKKEKGPTTLDDLLLRFDFRDSKPEVIDIGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.44
3 0.43
4 0.4
5 0.33
6 0.29
7 0.26
8 0.19
9 0.1
10 0.07
11 0.07
12 0.07
13 0.07
14 0.06
15 0.05
16 0.08
17 0.09
18 0.09
19 0.1
20 0.1
21 0.1
22 0.09
23 0.09
24 0.06
25 0.06
26 0.05
27 0.04
28 0.07
29 0.07
30 0.09
31 0.09
32 0.09
33 0.09
34 0.09
35 0.09
36 0.05
37 0.06
38 0.05
39 0.04
40 0.04
41 0.05
42 0.05
43 0.05
44 0.06
45 0.11
46 0.14
47 0.24
48 0.35
49 0.44
50 0.55
51 0.65
52 0.74
53 0.8
54 0.88
55 0.88
56 0.86
57 0.87
58 0.8
59 0.78
60 0.77
61 0.72
62 0.68
63 0.67
64 0.67
65 0.64
66 0.64
67 0.59
68 0.56
69 0.54
70 0.48
71 0.41
72 0.34
73 0.29
74 0.27
75 0.24
76 0.16
77 0.15
78 0.19
79 0.18
80 0.24
81 0.25
82 0.27
83 0.28
84 0.29