Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166ATW5

Protein Details
Accession A0A166ATW5    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
14-35SSSTRNRHGQRKFSRRIFKKAGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 4.5, cyto_nucl 4.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000095  CRIB_dom  
PROSITE View protein in PROSITE  
PS50108  CRIB  
Amino Acid Sequences MHLWLISPNFPPVSSSTRNRHGQRKFSRRIFKKAGEISQIGVTPSVHSYIAKQSREYWWWGDNYSRPNSKHDNFQHNRHIGKSNQCCRSYYSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.35
3 0.39
4 0.46
5 0.55
6 0.59
7 0.65
8 0.66
9 0.7
10 0.74
11 0.78
12 0.79
13 0.8
14 0.84
15 0.81
16 0.82
17 0.79
18 0.73
19 0.71
20 0.67
21 0.6
22 0.54
23 0.48
24 0.4
25 0.34
26 0.3
27 0.21
28 0.16
29 0.12
30 0.09
31 0.09
32 0.08
33 0.07
34 0.07
35 0.08
36 0.15
37 0.21
38 0.22
39 0.22
40 0.23
41 0.27
42 0.29
43 0.31
44 0.26
45 0.22
46 0.23
47 0.23
48 0.24
49 0.25
50 0.28
51 0.32
52 0.35
53 0.34
54 0.38
55 0.46
56 0.45
57 0.51
58 0.53
59 0.58
60 0.57
61 0.64
62 0.68
63 0.66
64 0.66
65 0.59
66 0.57
67 0.52
68 0.57
69 0.6
70 0.59
71 0.62
72 0.62
73 0.6