Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166KID5

Protein Details
Accession A0A166KID5    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
61-82RDEPSRKRRRTQPHEPPSKRESBasic
NLS Segment(s)
PositionSequence
64-80PSRKRRRTQPHEPPSKR
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MLAPTATSHGQPMRRAHTHTRPDAQESPTPVRSAGAMHAPYQMAPYPNPSTSARNADHRERDEPSRKRRRTQPHEPPSKRESTSASAGLRIRLPAARPIHRADAGGVGVDVRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.49
3 0.54
4 0.59
5 0.63
6 0.64
7 0.66
8 0.61
9 0.63
10 0.63
11 0.58
12 0.52
13 0.48
14 0.48
15 0.42
16 0.39
17 0.32
18 0.28
19 0.24
20 0.21
21 0.16
22 0.16
23 0.15
24 0.15
25 0.16
26 0.16
27 0.16
28 0.16
29 0.16
30 0.12
31 0.11
32 0.15
33 0.16
34 0.17
35 0.2
36 0.2
37 0.22
38 0.23
39 0.29
40 0.26
41 0.3
42 0.34
43 0.35
44 0.39
45 0.38
46 0.38
47 0.35
48 0.41
49 0.44
50 0.48
51 0.54
52 0.6
53 0.61
54 0.66
55 0.73
56 0.77
57 0.76
58 0.79
59 0.8
60 0.79
61 0.87
62 0.83
63 0.8
64 0.74
65 0.71
66 0.61
67 0.52
68 0.47
69 0.4
70 0.4
71 0.39
72 0.34
73 0.32
74 0.31
75 0.31
76 0.27
77 0.23
78 0.2
79 0.18
80 0.19
81 0.23
82 0.29
83 0.33
84 0.36
85 0.4
86 0.44
87 0.43
88 0.42
89 0.35
90 0.32
91 0.26
92 0.23
93 0.18