Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4V4M8

Protein Details
Accession E4V4M8    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
98-122GWVSLAKRQKRQGREQRRRRDEELSHydrophilic
NLS Segment(s)
PositionSequence
104-117KRQKRQGREQRRRR
Subcellular Location(s) nucl 13, mito 10, cyto 2, plas 2
Family & Domain DBs
Amino Acid Sequences MTGQAMSDQTPWWQFSWELSTGWSILASIGQVTPLSQASKNRNLLSLGRERQDTGTKKKRRVEHPCSFQSECSPTTSCGWRQGKVHPCFTTPKQAKMGWVSLAKRQKRQGREQRRRRDEELS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.24
4 0.22
5 0.19
6 0.19
7 0.19
8 0.17
9 0.17
10 0.13
11 0.08
12 0.07
13 0.07
14 0.06
15 0.05
16 0.05
17 0.05
18 0.05
19 0.05
20 0.07
21 0.08
22 0.1
23 0.11
24 0.18
25 0.24
26 0.32
27 0.36
28 0.35
29 0.36
30 0.36
31 0.35
32 0.34
33 0.37
34 0.32
35 0.29
36 0.29
37 0.28
38 0.28
39 0.34
40 0.34
41 0.35
42 0.42
43 0.47
44 0.54
45 0.59
46 0.64
47 0.67
48 0.72
49 0.72
50 0.72
51 0.73
52 0.71
53 0.71
54 0.64
55 0.55
56 0.47
57 0.41
58 0.32
59 0.27
60 0.23
61 0.19
62 0.21
63 0.24
64 0.22
65 0.29
66 0.31
67 0.31
68 0.32
69 0.39
70 0.46
71 0.47
72 0.53
73 0.44
74 0.44
75 0.48
76 0.49
77 0.51
78 0.45
79 0.46
80 0.44
81 0.44
82 0.45
83 0.43
84 0.43
85 0.37
86 0.4
87 0.36
88 0.39
89 0.47
90 0.49
91 0.51
92 0.58
93 0.62
94 0.64
95 0.74
96 0.77
97 0.79
98 0.85
99 0.88
100 0.9
101 0.92
102 0.91