Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166Q2A6

Protein Details
Accession A0A166Q2A6   
Localization Confidence High
Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
132-151KLIGKKKKLDRREAVRERKABasic
277-311SLGKRKAPSLPSKPTQKRPEKKPKRGPRVEVEYEQHydrophilic
NLS Segment(s)
PositionSequence
122-151MRRMKLKQQPKLIGKKKKLDRREAVRERKA
272-304PAPKPSLGKRKAPSLPSKPTQKRPEKKPKRGPR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR029004  L28e/Mak16  
IPR006958  Mak16  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF04874  Mak16  
PF01778  Ribosomal_L28e  
Amino Acid Sequences MQSDDVIWSVINQQFCSYKVKTTTQNFCRNEYNVTGLCNRQSCPLANSRYATVREKEGVLYLYMKTIERAHTPAHMWERVKLSNNYSKALEQIDKELIYWPNFTIHKCKQRVTKITQYLIKMRRMKLKQQPKLIGKKKKLDRREAVRERKALSAAHLERSIEKELIERLKSKAYGDAPLNVNENVWQAILDREKKSERMELTEDGELELQDDETDEEELEEEEMDGEWGEREFVSDMSGDEDGLSDLEDAADSGDDPNDSEEEEDDSSEDKPAPKPSLGKRKAPSLPSKPTQKRPEKKPKRGPRVEVEYEQELESVPLTRSALDNW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.3
4 0.26
5 0.29
6 0.33
7 0.39
8 0.46
9 0.53
10 0.62
11 0.64
12 0.73
13 0.69
14 0.68
15 0.68
16 0.61
17 0.56
18 0.48
19 0.45
20 0.36
21 0.37
22 0.35
23 0.32
24 0.35
25 0.33
26 0.31
27 0.29
28 0.31
29 0.3
30 0.31
31 0.37
32 0.37
33 0.39
34 0.4
35 0.39
36 0.41
37 0.43
38 0.43
39 0.37
40 0.36
41 0.34
42 0.33
43 0.31
44 0.27
45 0.24
46 0.2
47 0.19
48 0.15
49 0.15
50 0.15
51 0.15
52 0.14
53 0.16
54 0.17
55 0.18
56 0.21
57 0.2
58 0.22
59 0.24
60 0.28
61 0.31
62 0.34
63 0.32
64 0.34
65 0.37
66 0.38
67 0.42
68 0.39
69 0.4
70 0.42
71 0.43
72 0.41
73 0.38
74 0.34
75 0.31
76 0.31
77 0.28
78 0.21
79 0.22
80 0.22
81 0.2
82 0.2
83 0.22
84 0.21
85 0.2
86 0.2
87 0.17
88 0.2
89 0.21
90 0.22
91 0.27
92 0.32
93 0.4
94 0.43
95 0.48
96 0.51
97 0.59
98 0.65
99 0.65
100 0.66
101 0.64
102 0.66
103 0.65
104 0.6
105 0.59
106 0.56
107 0.57
108 0.53
109 0.5
110 0.54
111 0.53
112 0.59
113 0.61
114 0.66
115 0.66
116 0.68
117 0.73
118 0.72
119 0.79
120 0.79
121 0.78
122 0.75
123 0.77
124 0.77
125 0.77
126 0.77
127 0.76
128 0.75
129 0.74
130 0.78
131 0.79
132 0.8
133 0.77
134 0.72
135 0.65
136 0.58
137 0.5
138 0.39
139 0.31
140 0.3
141 0.25
142 0.24
143 0.23
144 0.21
145 0.2
146 0.23
147 0.22
148 0.14
149 0.13
150 0.11
151 0.14
152 0.17
153 0.17
154 0.16
155 0.16
156 0.18
157 0.19
158 0.18
159 0.2
160 0.18
161 0.2
162 0.2
163 0.23
164 0.22
165 0.23
166 0.24
167 0.19
168 0.18
169 0.15
170 0.14
171 0.1
172 0.08
173 0.07
174 0.06
175 0.08
176 0.13
177 0.17
178 0.17
179 0.2
180 0.22
181 0.25
182 0.27
183 0.3
184 0.27
185 0.27
186 0.29
187 0.28
188 0.29
189 0.27
190 0.25
191 0.2
192 0.18
193 0.14
194 0.11
195 0.09
196 0.06
197 0.05
198 0.05
199 0.05
200 0.05
201 0.06
202 0.05
203 0.05
204 0.05
205 0.06
206 0.05
207 0.05
208 0.04
209 0.04
210 0.04
211 0.04
212 0.04
213 0.04
214 0.04
215 0.04
216 0.05
217 0.04
218 0.05
219 0.06
220 0.06
221 0.07
222 0.07
223 0.07
224 0.09
225 0.09
226 0.08
227 0.07
228 0.07
229 0.07
230 0.06
231 0.07
232 0.04
233 0.04
234 0.04
235 0.04
236 0.04
237 0.04
238 0.04
239 0.04
240 0.04
241 0.05
242 0.05
243 0.06
244 0.07
245 0.07
246 0.07
247 0.08
248 0.08
249 0.1
250 0.1
251 0.1
252 0.1
253 0.11
254 0.11
255 0.12
256 0.13
257 0.13
258 0.16
259 0.22
260 0.25
261 0.28
262 0.35
263 0.44
264 0.53
265 0.56
266 0.62
267 0.6
268 0.66
269 0.7
270 0.7
271 0.7
272 0.68
273 0.72
274 0.71
275 0.78
276 0.77
277 0.81
278 0.83
279 0.84
280 0.85
281 0.87
282 0.9
283 0.91
284 0.93
285 0.94
286 0.95
287 0.95
288 0.95
289 0.92
290 0.9
291 0.89
292 0.85
293 0.78
294 0.73
295 0.65
296 0.57
297 0.49
298 0.39
299 0.29
300 0.22
301 0.18
302 0.15
303 0.11
304 0.12
305 0.12
306 0.13