Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166TFS2

Protein Details
Accession A0A166TFS2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
53-73MQYNRFYRRSPRARPPWMSGRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 5, extr 3
Family & Domain DBs
Amino Acid Sequences GVKPLPNALSSTQRQVHWVASATICLCRVSVTAESAVTDIPKEPSGRYPRWAMQYNRFYRRSPRARPPWMSGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.33
4 0.27
5 0.26
6 0.2
7 0.17
8 0.18
9 0.16
10 0.15
11 0.14
12 0.12
13 0.1
14 0.09
15 0.09
16 0.1
17 0.1
18 0.1
19 0.1
20 0.1
21 0.1
22 0.1
23 0.1
24 0.07
25 0.06
26 0.06
27 0.06
28 0.08
29 0.09
30 0.09
31 0.17
32 0.24
33 0.26
34 0.29
35 0.33
36 0.36
37 0.42
38 0.49
39 0.46
40 0.49
41 0.57
42 0.62
43 0.66
44 0.64
45 0.6
46 0.62
47 0.68
48 0.67
49 0.67
50 0.69
51 0.72
52 0.78
53 0.82