Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166D7M7

Protein Details
Accession A0A166D7M7    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
25-49LSDQRARNRRQLRVHRRRHQPPSDGBasic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 12, cyto 9, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR046938  DNA_clamp_sf  
IPR022648  Pr_cel_nuc_antig_N  
Gene Ontology GO:0003677  F:DNA binding  
GO:0006275  P:regulation of DNA replication  
Pfam View protein in Pfam  
PF00705  PCNA_N  
Amino Acid Sequences MLGAGLDHAIMFKRLLDSHRLTAILSDQRARNRRQLRVHRRRHQPPSDGQLARRVSVNLDAVGSTKYRCDRRMPLGVNLGSWKKVLKRTKDDDVVTLKAGMMLMC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.22
4 0.26
5 0.28
6 0.3
7 0.29
8 0.26
9 0.25
10 0.28
11 0.26
12 0.23
13 0.23
14 0.25
15 0.33
16 0.39
17 0.41
18 0.46
19 0.48
20 0.55
21 0.61
22 0.69
23 0.72
24 0.77
25 0.85
26 0.85
27 0.88
28 0.89
29 0.89
30 0.85
31 0.79
32 0.74
33 0.69
34 0.68
35 0.59
36 0.5
37 0.48
38 0.41
39 0.36
40 0.31
41 0.24
42 0.16
43 0.18
44 0.18
45 0.1
46 0.1
47 0.09
48 0.09
49 0.1
50 0.09
51 0.07
52 0.09
53 0.15
54 0.18
55 0.21
56 0.26
57 0.32
58 0.39
59 0.48
60 0.48
61 0.47
62 0.51
63 0.49
64 0.44
65 0.42
66 0.36
67 0.28
68 0.25
69 0.23
70 0.21
71 0.29
72 0.37
73 0.42
74 0.5
75 0.56
76 0.65
77 0.7
78 0.67
79 0.64
80 0.61
81 0.54
82 0.46
83 0.39
84 0.3
85 0.23