Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166AEA0

Protein Details
Accession A0A166AEA0    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
63-87SSTPSTTSKRRSRTRRAFRPTNSTSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Pfam View protein in Pfam  
PF00240  ubiquitin  
Amino Acid Sequences MLYMKNPPDQQHLIFAEKQLENQCTLSNIQKDSALHLVLRLCGGTQIFVKILTQQDGHAEVESSTPSTTSKRRSRTRRAFRPTNSTSSSPSSGLIAAAPSHIEVFVKALNGPDDRARD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.37
3 0.36
4 0.32
5 0.34
6 0.31
7 0.29
8 0.27
9 0.26
10 0.25
11 0.2
12 0.22
13 0.25
14 0.24
15 0.23
16 0.22
17 0.24
18 0.23
19 0.24
20 0.25
21 0.19
22 0.15
23 0.16
24 0.16
25 0.14
26 0.14
27 0.1
28 0.07
29 0.08
30 0.08
31 0.07
32 0.07
33 0.08
34 0.08
35 0.08
36 0.08
37 0.09
38 0.11
39 0.11
40 0.11
41 0.1
42 0.11
43 0.13
44 0.13
45 0.1
46 0.09
47 0.08
48 0.08
49 0.08
50 0.07
51 0.05
52 0.05
53 0.06
54 0.09
55 0.13
56 0.22
57 0.29
58 0.38
59 0.48
60 0.57
61 0.68
62 0.76
63 0.83
64 0.85
65 0.87
66 0.87
67 0.82
68 0.83
69 0.76
70 0.71
71 0.65
72 0.56
73 0.5
74 0.46
75 0.43
76 0.34
77 0.29
78 0.24
79 0.19
80 0.17
81 0.14
82 0.1
83 0.08
84 0.08
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.06
91 0.08
92 0.09
93 0.1
94 0.1
95 0.12
96 0.15
97 0.16
98 0.19