Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166LJR0

Protein Details
Accession A0A166LJR0   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
67-91DERVMPKGPMFPRRRRRRRPRDAATBasic
NLS Segment(s)
PositionSequence
75-88PMFPRRRRRRRPRD
Subcellular Location(s) nucl 15, cyto_nucl 11.5, cyto 6, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011993  PH-like_dom_sf  
IPR001849  PH_domain  
PROSITE View protein in PROSITE  
PS50003  PH_DOMAIN  
Amino Acid Sequences PDPADLIRAYSVQNAESGLGNDYVKRKNVIRVRMEGEQFLLQAQDVADVVEWIEGLHAATNIALDLDERVMPKGPMFPRRRRRRRPRDAAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.13
5 0.11
6 0.12
7 0.11
8 0.13
9 0.17
10 0.19
11 0.2
12 0.22
13 0.23
14 0.3
15 0.37
16 0.43
17 0.43
18 0.45
19 0.47
20 0.49
21 0.48
22 0.39
23 0.34
24 0.26
25 0.22
26 0.17
27 0.12
28 0.07
29 0.06
30 0.06
31 0.04
32 0.04
33 0.04
34 0.03
35 0.03
36 0.04
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.04
48 0.04
49 0.03
50 0.03
51 0.03
52 0.04
53 0.05
54 0.06
55 0.07
56 0.08
57 0.1
58 0.1
59 0.11
60 0.18
61 0.23
62 0.32
63 0.39
64 0.49
65 0.59
66 0.7
67 0.81
68 0.84
69 0.91
70 0.92
71 0.95