Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4V6D2

Protein Details
Accession E4V6D2    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
58-82APSVESQRVKRRRRRSLVAGRTPSTHydrophilic
NLS Segment(s)
PositionSequence
66-72VKRRRRR
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MHDDAARKQYDNGPSSSAPHAVSSGYQPGSKVNDEAKQLSTMNAEEPVDPQIRRTRVAPSVESQRVKRRRRRSLVAGRTPSTGCQKYKDSRKGNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.35
4 0.31
5 0.23
6 0.21
7 0.19
8 0.15
9 0.15
10 0.14
11 0.16
12 0.15
13 0.15
14 0.15
15 0.17
16 0.2
17 0.2
18 0.2
19 0.18
20 0.21
21 0.23
22 0.24
23 0.23
24 0.21
25 0.21
26 0.19
27 0.17
28 0.14
29 0.12
30 0.11
31 0.11
32 0.09
33 0.09
34 0.11
35 0.12
36 0.12
37 0.13
38 0.18
39 0.19
40 0.2
41 0.21
42 0.23
43 0.27
44 0.3
45 0.3
46 0.27
47 0.35
48 0.4
49 0.42
50 0.41
51 0.46
52 0.53
53 0.6
54 0.66
55 0.68
56 0.73
57 0.79
58 0.84
59 0.84
60 0.86
61 0.87
62 0.87
63 0.84
64 0.74
65 0.69
66 0.61
67 0.54
68 0.52
69 0.47
70 0.39
71 0.38
72 0.44
73 0.5
74 0.6
75 0.67