Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166RIU6

Protein Details
Accession A0A166RIU6    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
50-75AYLTRPTSPRPPPCHRRQYQPSCEALHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 6, mito 3, extr 2
Family & Domain DBs
Amino Acid Sequences LLFLSLDYWAGCFIFSSTSLYDLFPNSRVRSAISPRQRSVSRIPTRSCLAYLTRPTSPRPPPCHRRQYQPSCEALQST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.11
4 0.1
5 0.12
6 0.13
7 0.13
8 0.14
9 0.14
10 0.15
11 0.15
12 0.19
13 0.19
14 0.2
15 0.2
16 0.21
17 0.24
18 0.29
19 0.34
20 0.39
21 0.43
22 0.43
23 0.48
24 0.46
25 0.45
26 0.45
27 0.47
28 0.45
29 0.45
30 0.45
31 0.44
32 0.45
33 0.43
34 0.37
35 0.29
36 0.25
37 0.25
38 0.28
39 0.29
40 0.31
41 0.32
42 0.35
43 0.41
44 0.47
45 0.5
46 0.54
47 0.6
48 0.66
49 0.75
50 0.82
51 0.78
52 0.8
53 0.82
54 0.84
55 0.84
56 0.81
57 0.76
58 0.69