Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166TNU1

Protein Details
Accession A0A166TNU1    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-31GPSNLSKAKKPKGKDKKPINAGKIKKBasic
NLS Segment(s)
PositionSequence
12-32KAKKPKGKDKKPINAGKIKKT
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR014014  RNA_helicase_DEAD_Q_motif  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016787  F:hydrolase activity  
GO:0003724  F:RNA helicase activity  
PROSITE View protein in PROSITE  
PS51195  Q_MOTIF  
Amino Acid Sequences MGPQAGPSNLSKAKKPKGKDKKPINAGKIKKTTEKQRVVELEKAAVEFVAAPDLKSFNDLPISEFTKRGLKKAFFKEMTDIQAKSLPETLALPVGVPPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.65
4 0.7
5 0.78
6 0.82
7 0.84
8 0.84
9 0.88
10 0.9
11 0.86
12 0.84
13 0.79
14 0.78
15 0.75
16 0.68
17 0.65
18 0.63
19 0.65
20 0.66
21 0.69
22 0.61
23 0.61
24 0.63
25 0.59
26 0.57
27 0.47
28 0.38
29 0.3
30 0.28
31 0.2
32 0.14
33 0.1
34 0.06
35 0.05
36 0.06
37 0.05
38 0.05
39 0.06
40 0.07
41 0.07
42 0.09
43 0.09
44 0.08
45 0.11
46 0.11
47 0.12
48 0.15
49 0.2
50 0.18
51 0.19
52 0.2
53 0.25
54 0.25
55 0.28
56 0.32
57 0.33
58 0.41
59 0.49
60 0.57
61 0.51
62 0.53
63 0.54
64 0.5
65 0.5
66 0.45
67 0.38
68 0.3
69 0.31
70 0.29
71 0.26
72 0.25
73 0.2
74 0.17
75 0.18
76 0.17
77 0.15
78 0.15
79 0.13