Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4V3R4

Protein Details
Accession E4V3R4    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPSKQYKKTKKESSLHHASGHydrophilic
NLS Segment(s)
PositionSequence
21-24KGSK
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MPSKQYKKTKKESSLHHASGKGSKSPVKSKGRQIEGGCPPFTPYTRQRGNVQQEIAMLRNEKLPDGKLHVSILLAWIKAWLGIRRLKIPAKVTGEGRTEHPSES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.78
3 0.72
4 0.64
5 0.56
6 0.54
7 0.47
8 0.41
9 0.34
10 0.34
11 0.35
12 0.4
13 0.47
14 0.5
15 0.54
16 0.6
17 0.66
18 0.66
19 0.67
20 0.62
21 0.61
22 0.6
23 0.58
24 0.49
25 0.4
26 0.37
27 0.32
28 0.31
29 0.27
30 0.23
31 0.28
32 0.31
33 0.34
34 0.36
35 0.43
36 0.48
37 0.46
38 0.43
39 0.35
40 0.31
41 0.3
42 0.27
43 0.2
44 0.14
45 0.1
46 0.12
47 0.12
48 0.12
49 0.12
50 0.12
51 0.13
52 0.18
53 0.19
54 0.18
55 0.18
56 0.18
57 0.16
58 0.15
59 0.16
60 0.12
61 0.1
62 0.09
63 0.09
64 0.09
65 0.1
66 0.13
67 0.13
68 0.16
69 0.21
70 0.24
71 0.28
72 0.34
73 0.37
74 0.4
75 0.41
76 0.45
77 0.47
78 0.48
79 0.47
80 0.48
81 0.46
82 0.42
83 0.42
84 0.39