Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4V1T8

Protein Details
Accession E4V1T8    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
94-147IHKTGCRVDGRRRRRRRRRRGKREEEEEEEDERREGDKRKQRKRGAIRGVRSTGBasic
NLS Segment(s)
PositionSequence
103-145GRRRRRRRRRRGKREEEEEEEDERREGDKRKQRKRGAIRGVRS
Subcellular Location(s) cyto 12.5, cyto_nucl 9.5, mito 7, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MGELLRVMLAWGERAGGPGGAGSVGVAGRAAEMTLRVHGETGGRGVWVRGVAWRRRGLRGRPVGSVGRGGCRSERGATLALVSKTELESRAHEIHKTGCRVDGRRRRRRRRRRGKREEEEEEEDERREGDKRKQRKRGAIRGVRSTGLKEAPKEYIGSKLSDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.09
4 0.09
5 0.08
6 0.08
7 0.06
8 0.06
9 0.04
10 0.05
11 0.04
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.04
18 0.04
19 0.05
20 0.06
21 0.08
22 0.09
23 0.09
24 0.09
25 0.1
26 0.1
27 0.1
28 0.1
29 0.09
30 0.08
31 0.08
32 0.08
33 0.08
34 0.08
35 0.08
36 0.11
37 0.18
38 0.22
39 0.28
40 0.34
41 0.36
42 0.43
43 0.5
44 0.5
45 0.54
46 0.58
47 0.55
48 0.5
49 0.51
50 0.45
51 0.39
52 0.37
53 0.28
54 0.23
55 0.21
56 0.2
57 0.17
58 0.17
59 0.18
60 0.16
61 0.16
62 0.14
63 0.14
64 0.13
65 0.13
66 0.14
67 0.13
68 0.12
69 0.11
70 0.09
71 0.09
72 0.1
73 0.1
74 0.08
75 0.1
76 0.15
77 0.18
78 0.19
79 0.19
80 0.19
81 0.23
82 0.27
83 0.27
84 0.23
85 0.24
86 0.27
87 0.32
88 0.41
89 0.46
90 0.52
91 0.61
92 0.72
93 0.79
94 0.86
95 0.93
96 0.94
97 0.95
98 0.96
99 0.97
100 0.97
101 0.97
102 0.96
103 0.94
104 0.9
105 0.86
106 0.8
107 0.72
108 0.64
109 0.54
110 0.44
111 0.34
112 0.27
113 0.21
114 0.2
115 0.22
116 0.28
117 0.37
118 0.47
119 0.58
120 0.68
121 0.75
122 0.82
123 0.87
124 0.88
125 0.89
126 0.88
127 0.85
128 0.83
129 0.77
130 0.69
131 0.6
132 0.52
133 0.45
134 0.43
135 0.39
136 0.33
137 0.34
138 0.34
139 0.34
140 0.33
141 0.3
142 0.31
143 0.29