Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4V0Q8

Protein Details
Accession E4V0Q8   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
50-72TADGQQIRRKRRRKDPIPAGDEAHydrophilic
NLS Segment(s)
PositionSequence
57-63RRKRRRK
Subcellular Location(s) extr 10, mito 5, golg 3, nucl 2, plas 2, pero 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MSSHLHPRSRSTMSLFTATLLASLLIVGVPHVFPCPAPRRALADSEIIVTADGQQIRRKRRRKDPIPAGDEASSPSDQLAGQSLLGSTTTNIISQTPTVGQELREQAAQFRYMEAEAKELEKTARECPVPKPKGILGQLLGFGADKSDELKAESPNTDIQWKRNTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.39
3 0.32
4 0.29
5 0.25
6 0.19
7 0.13
8 0.09
9 0.06
10 0.06
11 0.05
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.05
18 0.06
19 0.06
20 0.06
21 0.14
22 0.21
23 0.24
24 0.26
25 0.28
26 0.33
27 0.35
28 0.38
29 0.32
30 0.28
31 0.25
32 0.23
33 0.21
34 0.16
35 0.13
36 0.1
37 0.09
38 0.09
39 0.1
40 0.11
41 0.16
42 0.22
43 0.32
44 0.42
45 0.5
46 0.56
47 0.66
48 0.76
49 0.8
50 0.85
51 0.86
52 0.86
53 0.82
54 0.75
55 0.66
56 0.55
57 0.46
58 0.36
59 0.28
60 0.18
61 0.13
62 0.11
63 0.09
64 0.08
65 0.08
66 0.08
67 0.06
68 0.06
69 0.06
70 0.06
71 0.05
72 0.05
73 0.05
74 0.04
75 0.05
76 0.05
77 0.05
78 0.06
79 0.06
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.08
86 0.09
87 0.09
88 0.13
89 0.15
90 0.15
91 0.15
92 0.15
93 0.16
94 0.17
95 0.18
96 0.14
97 0.12
98 0.12
99 0.12
100 0.14
101 0.12
102 0.12
103 0.11
104 0.13
105 0.12
106 0.12
107 0.12
108 0.13
109 0.15
110 0.16
111 0.2
112 0.22
113 0.24
114 0.32
115 0.42
116 0.42
117 0.41
118 0.43
119 0.4
120 0.46
121 0.46
122 0.42
123 0.33
124 0.31
125 0.31
126 0.26
127 0.24
128 0.16
129 0.13
130 0.09
131 0.08
132 0.06
133 0.07
134 0.09
135 0.09
136 0.12
137 0.15
138 0.17
139 0.21
140 0.22
141 0.22
142 0.25
143 0.27
144 0.32
145 0.33
146 0.36