Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166ED11

Protein Details
Accession A0A166ED11    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
103-126LQASKKEKKAAPPAKKPRGNKAKAHydrophilic
NLS Segment(s)
PositionSequence
66-126HIRPTSGGRRALGISARHARKGYRADLHKAVLGRVSALQASKKEKKAAPPAKKPRGNKAKA
Subcellular Location(s) nucl 19, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR029004  L28e/Mak16  
IPR002672  Ribosomal_L28e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01778  Ribosomal_L28e  
Amino Acid Sequences MVKRVPEGPIFSREPGNLRNLHSYKYSGLANPKNIHIHDDGSGIRITSHASHANPHKVSKAKASTHIRPTSGGRRALGISARHARKGYRADLHKAVLGRVSALQASKKEKKAAPPAKKPRGNKAKAAAAEAAAVDEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.33
3 0.35
4 0.32
5 0.32
6 0.41
7 0.39
8 0.39
9 0.38
10 0.37
11 0.32
12 0.31
13 0.29
14 0.23
15 0.31
16 0.33
17 0.38
18 0.38
19 0.4
20 0.41
21 0.4
22 0.4
23 0.33
24 0.29
25 0.23
26 0.23
27 0.2
28 0.17
29 0.17
30 0.13
31 0.11
32 0.1
33 0.1
34 0.08
35 0.11
36 0.13
37 0.13
38 0.18
39 0.23
40 0.3
41 0.3
42 0.3
43 0.32
44 0.32
45 0.33
46 0.35
47 0.37
48 0.32
49 0.39
50 0.45
51 0.47
52 0.52
53 0.53
54 0.46
55 0.41
56 0.43
57 0.41
58 0.4
59 0.36
60 0.28
61 0.27
62 0.26
63 0.26
64 0.26
65 0.19
66 0.19
67 0.25
68 0.26
69 0.27
70 0.27
71 0.26
72 0.29
73 0.33
74 0.33
75 0.33
76 0.36
77 0.4
78 0.42
79 0.43
80 0.39
81 0.34
82 0.29
83 0.23
84 0.19
85 0.14
86 0.12
87 0.12
88 0.1
89 0.11
90 0.14
91 0.16
92 0.25
93 0.31
94 0.35
95 0.4
96 0.42
97 0.5
98 0.58
99 0.65
100 0.67
101 0.71
102 0.78
103 0.82
104 0.87
105 0.84
106 0.84
107 0.84
108 0.79
109 0.76
110 0.73
111 0.71
112 0.65
113 0.63
114 0.53
115 0.43
116 0.38
117 0.3
118 0.22