Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166PRP2

Protein Details
Accession A0A166PRP2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
95-119VVRAWVARRKQKKVRIGIGHRAKKGBasic
NLS Segment(s)
PositionSequence
101-118ARRKQKKVRIGIGHRAKK
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR002132  Ribosomal_L5  
IPR022803  Ribosomal_L5_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Amino Acid Sequences MSSPHVPRCHPSLCSRRCGRTWAVLPYSLPVSTLLPPQASFSDTNTPAHVTIHGPKAEELLEHELKVKKYELRRGNFSETGNLGLGVREHIGRAVVRAWVARRKQKKVRIGIGHRAKKGDTQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.62
3 0.63
4 0.6
5 0.62
6 0.56
7 0.55
8 0.55
9 0.53
10 0.49
11 0.44
12 0.42
13 0.38
14 0.36
15 0.26
16 0.21
17 0.15
18 0.14
19 0.13
20 0.15
21 0.15
22 0.13
23 0.14
24 0.15
25 0.15
26 0.15
27 0.14
28 0.15
29 0.2
30 0.21
31 0.21
32 0.2
33 0.21
34 0.19
35 0.18
36 0.16
37 0.12
38 0.14
39 0.18
40 0.18
41 0.17
42 0.17
43 0.17
44 0.16
45 0.14
46 0.13
47 0.14
48 0.14
49 0.14
50 0.17
51 0.19
52 0.19
53 0.21
54 0.2
55 0.19
56 0.23
57 0.33
58 0.37
59 0.39
60 0.45
61 0.48
62 0.53
63 0.51
64 0.47
65 0.41
66 0.33
67 0.3
68 0.24
69 0.2
70 0.14
71 0.11
72 0.1
73 0.08
74 0.08
75 0.06
76 0.06
77 0.07
78 0.08
79 0.08
80 0.09
81 0.09
82 0.1
83 0.11
84 0.13
85 0.17
86 0.24
87 0.31
88 0.4
89 0.48
90 0.57
91 0.66
92 0.73
93 0.78
94 0.8
95 0.83
96 0.83
97 0.83
98 0.84
99 0.85
100 0.84
101 0.78
102 0.71
103 0.62