Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166DM21

Protein Details
Accession A0A166DM21    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-33PGKPQVPVPKNRTRSKRNNQTQHVQVTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9, nucl 8.5, cyto 8.5, mito 6, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000571  Znf_CCCH  
Gene Ontology GO:0046872  F:metal ion binding  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MTSEAPPGKPQVPVPKNRTRSKRNNQTQHVQVTDNLKFDGICCFFIQGHCEFGDVCKRSHGDPPGEVTPSLTARMPTDISQTQDIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.62
3 0.69
4 0.75
5 0.79
6 0.78
7 0.81
8 0.83
9 0.86
10 0.87
11 0.88
12 0.86
13 0.84
14 0.8
15 0.74
16 0.65
17 0.55
18 0.47
19 0.42
20 0.38
21 0.31
22 0.24
23 0.19
24 0.16
25 0.16
26 0.18
27 0.13
28 0.12
29 0.11
30 0.12
31 0.12
32 0.13
33 0.15
34 0.11
35 0.11
36 0.1
37 0.11
38 0.09
39 0.11
40 0.19
41 0.17
42 0.17
43 0.19
44 0.2
45 0.22
46 0.28
47 0.32
48 0.28
49 0.28
50 0.34
51 0.33
52 0.34
53 0.32
54 0.27
55 0.24
56 0.22
57 0.21
58 0.17
59 0.15
60 0.15
61 0.18
62 0.19
63 0.17
64 0.23
65 0.24
66 0.27